ࡱ> A8   0  !"#$%&')*+,-./2143c567DI:;<=>?@ABC EFXHJEKLVOPQRSTUGWKYZ[\]^_`abedqfghijklmnopsrtuvwxyz{|}~Root Entry) FAV9@aSummaryInformation(?8@H?CAED1HN@H?dA/B6H V@H?;C8DE @H??wElDj>D/H7(T-@H??wElDj;E$H |@HA0C;;B&F7BB4FhD&B H6tring.A unique key that identifies the particular string.OSISComponentExtendedFilterPropertybitwise addition of OSsProperty to set if you want to filter a componentAction_ISCustomActionReferenceFileTypeContents of the file speciifed in ISCAReferenceFilePath. This column is only used by MSI.Foreign key into theICustomAction table.file type of the file specified ISCAReferenceFilePath. This column is only used by MSI.InstallingInstalledUninstallingInstallTextCmdLineISSelfRegForeign key to the file tableCostFinalizeCostInitializeFileCostInstallAdminPackageInstallFilesInstallValidateInstallFinalizeInstallInitializeISSCHEDULEREBOOTScheduleRebootAdminWelcomeExecuteActionSetupCompleteErrorSetupCompleteSuccessSetupInitializationSetupInterruptedSetupProgressCreateShortcutsPublishComponentsPublishFeaturesPublishProductRegisterClassInfoRegisterExtensionInfoRegisterMIMEInfoRegisterProgIdInfoRegisterTypeLibrariesNOT InstalledAllocateRegistrySpaceCCP_TESTCreateFoldersVersionNTDeleteServicesDuplicateFilesNOT ISSETUPDRIVENFindRelatedProductsInstallODBCInstallServicesLaunchConditionsMigrateFeatureStatesMoveFilesPatchFilesProcessComponentsNot CCP_SUCCESS And CCP_TESTRMCCPSearchRegisterComPlusRegisterFontsRegisterProductRegisterUserRemoveDuplicateFilesRemoveEnvironmentStringsRemoveExistingProductsRemoveFoldersRemoveIniValuesRemoveODBCRemoveRegistryValuesRemoveShortcutsSelfRegModulesSelfUnregModulesSetODBCFoldersStartServicesStopServicesUnpublishComponentsUnpublishFeaturesUnregisterClassInfoUnregisterComPlusUnregisterExtensionInfoUnregisterFontsUnregisterMIMEInfoUnregisterProgIdInfoUnregisterTypeLibrariesWriteEnvironmentStringsWriteIniValuesWriteRegistryValuesISSelfRegisterCostingISSelfRegisterFilesISSelfRegisterFinalizeNot InstalledISSetAllUsersISUnSelfRegisterFilesREMOVE="ALL"RemoveFilesCAMakePropsAvailableSetARPINSTALLLOCATIONSetInstallDirSetUnInstallerExeSourceUninstFlPropertyIsolateComponentsValidateProductIDNot Installed And (Not PATCH Or IS_MAJOR_UPGRADE)InstallWelcomeInstalled And Not RESUME And Not Preselected And Not PATCHMaintenanceWelcomePATCH And Not IS_MAJOR_UPGRADEPatchWelcomeInstalled And (RESUME Or Preselected) And Not PATCHSetupResumeVersionNT = 400SetAllUsersProfileNTVersionNT >= 500setAllUsersProfile2KsetUserProfileNTNot Installed And Not PATCHResolveSource.:ALLUSE~1|All UsersTARGETDIRALLUSERSPROFILE.:Admint~1|AdminToolsAdminToolsFolder.:APPLIC~1|Application DataAppDataFolderC__C__windows_system32_Macromed_Flash_.:Common~1|CommonAppDataCommonAppDataFolder.:Common64CommonFiles64Folder.:CommonCommonFilesFolder.:DesktopDesktopFolderFlashMACROMEDFLASH.:FAVORI~1|FavoritesFavoritesFolder.:FontsFontsFolder.:Global~1|GlobalAssemblyCacheGlobalAssemblyCache.INSTALLDIRInstal~1|InstallShieldISCommonFilesFolderUPDATE~1|UpdateServiceISUpdateServiceFolderYOURCO~1|Your Company NameProgramFilesFolderISYourCompanyDirYOURPR~1|Your Product NameISYourProductDir.:LocalA~1|LocalAppDataLocalAppDataFolderMacromedSystemFolder.:MyPict~1|MyPicturesMyPicturesFolderNEW_DIRECTORY1.:PersonalPersonalFolder.:Primar~1|PrimaryVolumePathPrimaryVolumePath.:Prog64~1|Program Files 64ProgramFiles64Folder.:PROGRA~1|program files.:ProgramsProgramMenuFolder.:SendToSendToFolder.:STARTM~1|Start MenuStartMenuFolder.:StartUpStartupFolder.:SystemSystem16Folder.:System64System64Folder.:System32SourceDir.:TempTempFolder.:ShellNewTemplateFolder.:USERPR~1|UserProfileUSERPROFILE.:WindowsWindowsFolder.:WinRootWindowsVolume_INSTALLDIR__INSTALLDIR_1_SystemFolder__SystemFolder_1_SystemFolder__Macromed_Flash_UninstFl.exeInstall Adobe Flash PlayerFlashPlayer9.0.45.0FlashPlayerMergeModule.52442A12_0334_40E2_BC90_E3BE2AD2E349FLASH.52442A12_0334_40E2_BC90_E3BE2AD2E349MACROMED.52442A12_0334_40E2_BC90_E3BE2AD2E349INSTALLDIR.52442A12_0334_40E2_BC90_E3BE2AD2E3491033Flash9c.ocxFlash.ocx.52442A12_0334_40E2_BC90_E3BE2AD2E349flash9c.ocx.52442A12_0334_40E2_BC90_E3BE2AD2E349FLASHU~1.EXE|FlashUtil9c.exeFlashUtil.exe1.52442A12_0334_40E2_BC90_E3BE2AD2E349flashutil9c.exe.52442A12_0334_40E2_BC90_E3BE2AD2E349Costing COM+ application: [1]IS_COMPLUS_PROGRESSTEXT_COSTInstalling COM+ application: [1]ISNameTableTypeYDescriptionName of the style. The primary key of this table. This name is embedded in the texts to indicate a style change.A combination of style bits.The size of the font used. This size is given in our units (1/12 of the system font height). Assuming that the system font is set to 12 point size, this is equivalent to the point size.A string indicating the name of the font used. Required. The string must be at most 31 characters long.A long integer indicating the color of the string in the RGB format (Red, Green, Blue each 0-255, RGB = R + 256*G + 256^2*B).The table key. The Signature represents a unique file signature.The minimum version of the file.TextActionTextActionTemplateAdminExecuteSequenceA named property to be tied to this item. All the items tied to the same property become part of the same listbox.ConditionA positive integer used to determine the ordering of the items within one list..The integers do not have to be consecutive.SequenceLocalizable text to display when condition fails and install must abort.AdminUISequenceAdvtExecuteSequenceAdvtUISequenceAppSearchPropertySignature_Name of property, uppercase if settable by launcher or loader.AttributesHeightWidthXFeature_FeatureOrderingBinaryDataThe value string associated with this button. Selecting the button will set the associated property to this value.The width of the button.BindImageFile_FileThe visible title to be assigned to the radio button.PathA named property to be tied to this radio button. All the buttons tied to the same property become part of the same group.CCPSearchCheckBoxValueArgumentComponent_ComponentY;N;@Base action to determine insert location.IconComboBoxOrderComponentIdDirectory_DirectoryKeyPathLevelControlControl_NextDialog_DialogHelpControlConditionTable name to ignore during merge operation.ModuleIgnoreTableControl_ModuleAdvtExecuteSequenceExcludedMinVersionControlEventMinimum version of excluded module.LanguageID of module with exclusion requirement.Maximum version of excluded module.EventExcludedMaxVersionString.GUID of module with exclusion requirement.An integer used to order several events tied to the same control. Can be left blank.Language of excluded module.CustomActionString.GUID of excluded module.SourceExcludedIDTargetModuleExclusionExcludedLanguageControl_CancelControl_DefaultVersion of the module.Control_FirstModule identifier (String.GUID).HCenteringDefault decimal language of module.TitleModuleInstallUISequenceVCenteringModuleInstallExecuteSequenceDefaultDirDirectory_ParentDrLocatorDepthLanguageID of the required module.ParentRequiredLanguageRequiredVersionVersion of the required version.RequiredIDDestFolderLanguage of module requiring the dependency.ModuleLanguageString.GUID of required module.FileKeyFile;Registry;ODBCDataSourceModule containing the component.Default language ID for module (may be changed by transform).Module requiring the dependency.ModuleDependencyErrorModuleSignatureMessageComponent contained in the module.EventMappingAttributeStandard Sequence numberModuleAdvtUISequenceModuleAdminUISequenceNullableBaseActionBefore (0) or After (1)The predefined root key for the registry value, one of rrkEnum.The registry value.The key for the registry value.DisplayThe vertical coordinate of the upper left corner of the bounding rectangle of the radio button.The registry value name.Feature_ParentThe horizontal coordinate of the upper left corner of the bounding rectangle of the radio button.RegPathForeign key into the Component table referencing component that controls the installing of the registry value.FeatureComponentsThe name of the control attribute, that is set when this event is received.The height of the button.FileNameFileSizeLanguageThe help strings used with the button. The text is optional.VersionString value for property. Never null or empty.File sequence number for the last file for this media.Disk name: the visible text actually printed on the disk. This will be used to prompt the user when this disk needs to be inserted.Primary key, integer to determine sort order for table.A string used to set the initial text contained within a control (if appropriate).KeyA string GUID unique to this component, version, and language.The value string associated with this item. Selecting the line will set the associated property to this value.If some or all of the files stored on the media are compressed in a cabinet, the name of that cabinet.The name of the icon to be displayed with the icon. The binary information is looked up from the Binary Table.A named property to be tied to this item. All the items tied to the same property become part of the same listview.InstallExecuteSequenceInstallUISequenceExpression which must evaluate to TRUE in order for install to commence.LaunchConditionInstallShieldListBoxThe help strings used with the button. The text is optional. ListViewBinary_Primary key, non-localized token.MediaCabinetDiskIdDiskPromptLastSequencePrimary key. Name of the icon file.VolumeLabelBinary stream. The binary icon data in PE (.DLL or .EXE) or icon (.ICO) format.AfterAction to insertModuleAdminExecuteSequenceModuleComponentsModuleIDList of decimal language Ids, comma-separated if more than one.The maximum size of the file. Size of file in bytes (long integer).The minimum size of the file.File name used for installation, may be localized. This may contain a "short name|long name" pair.The minimum creation date of the file.Primary key, non-localized token, must match identifier in cabinet. For uncompressed files, this field is ignored.The maximum version of the file.Foreign key referencing Component that controls the file.The maximum creation date of the file.Foreign key into Component table.The languages supported by the file.Short text identifying a visible feature item.The name of the file. This may contain a "short name|long name" pair.The install level at which record will be initially selected. An install level of 0 will disable an item and prevent its display.Optional key of a parent record in the same table. If the parent is not selected, then the record will not be installed. Null indicates a root item.Integer containing bit flags representing file attributes (with the decimal value of each bit position in parentheses)Foreign key into Feature table.Sequence with respect to the media images; order must track cabinet order.Version string for versioned files; Blank for unversioned files.Primary key used to identify a particular feature record.Numeric sort order, used to force a specific display ordering.The name of the Directory that can be configured by the UI. A non-null value will enable the browse button.UpperCaseLonger descriptive text describing a visible feature item.Feature attributes0;1;2;4;5;6;8;9;10;16;17;18;20;21;22;24;25;26;32;33;34;36;37;38;48;49;50;52;53;54An identifier that specifies the type of the event that the control subscribes to.A foreign key to the Dialog table, name of the Dialog.Error formatting template, obtained from user ed. or localizers.Integer error number, obtained from header file IError(...) macros.The Signature_ represents a unique file signature and is also the foreign key in the Signature table.Defines the control that has the focus when the dialog is created.Unique identifier for directory entry, primary key. If a property by this name is defined, it contains the full path to the directory.Reference to the entry in this table specifying the default parent directory. A record parented to itself or with a Null parent represents a root of the install tree.The default sub-path under parent's path.Width of the bounding rectangle of the dialog.The path on the user system. This is a either a subpath below the value of the Parent or a full path. The path may contain properties enclosed within [ ] that will be expanded.The parent file signature. It is also a foreign key in the Signature table. If null and the Path column does not expand to a full path, then all the fixed drives of the user system are searched using the Path.AnyPathThe depth below the path to which the Signature_ is recursively searched. If absent, the depth is assumed to be 0.A text string specifying the title to be displayed in the title bar of the dialog's window.Height of the bounding rectangle of the dialog.Vertical position of the dialog on a 0-100 scale. 0 means top end, 100 means bottom end of the screen, 50 center.Horizontal position of the dialog on a 0-100 scale. 0 means left end, 100 means right end of the screen, 50 center.Name of the dialog.Defines the default control. Hitting return is equivalent to pushing this button.Defines the cancel control. Hitting escape or clicking on the close icon on the dialog is equivalent to pushing this button.The numeric custom action type, consisting of source location, code type, entry, option flags.Excecution parameter, depends on the type of custom actionThe table reference of the source of the code.CustomSourceA 32-bit word that specifies the attribute flags to be applied to this dialog.Primary key, name of action, normally appears in sequence table unless private use.A foreign key to the Control table, name of the controlAn identifier that specifies the type of the event that should take place when the user interacts with control specified by the first two entries.A standard conditional statement that specifies under which conditions an event should be triggered.RadioButtonA standard conditional statement that specifies under which conditions the action should be triggered.External key to the Dialog table, name of the dialog.A foreign key to the Control table, name of the control.A foreign key to the Dialog table, name of the dialog.The name of a defined property to be linked to this control. The desired action to be taken on the specified control.Default;Disable;Enable;Hide;ShowA value to be used as a modifier when triggering a particular event.RegistryName of the control. This name must be unique within a dialog, but can repeat on different dialogs. A positive integer used to determine the ordering of the items within one list. The integers do not have to be consecutive.The visible text to be assigned to the item. Optional. If this entry or the entire column is missing, the text is the same as the value.RootExpression evaluated to determine if Level in the Feature table is to change.The name of an other control on the same dialog. This link defines the tab order of the controls. The links have to form one or more cycles!Reference to a Feature entry in Feature table.New selection Level to set in Feature table if Condition evaluates to TRUE.Either the primary key into the File table, Registry table, or ODBCDataSource table. This extract path is stored when the component is installed, and is used to detect the presence of the component and to return the path to it.A conditional statement that will disable this component if the specified condition evaluates to the 'True' state. If a component is disabled, it will not be installed, regardless of the 'Action' state associated with the component.Required key of a Directory table record. This is actually a property name whose value contains the actual path, set either by the AppSearch action or with the default setting obtained from the Directory table.Primary key used to identify a particular component record.Remote execution option, one of irsEnumA named property to be tied to this item. All the items tied to the same property become part of the same combobox.CostFilenameThe value string associated with the item.A named property to be tied to the item.The unformatted binary data.Unique key identifying the binary data.The label attributed to the volume.The property defining the location of the cabinet file.The type of the control.Horizontal coordinate of the upper left corner of the bounding rectangle of the control.Height of the bounding rectangle of the control.Vertical coordinate of the upper left corner of the bounding rectangle of the control.Width of the bounding rectangle of the control.SignatureA 32-bit word that specifies the attribute flags to be applied to this control.LanguagesSignature;RegLocator;IniLocator;DrLocator;CompLocatorMaxDateThe property associated with a SignatureMaxSizeFormattedMaxVersionGuidMinDateNumber that determines the sort order in which the actions are to be executed. Leave blank to suppress action.MinSizeOptional expression which skips the action if evaluates to expFalse.If the expression syntax is invalid, the engine will terminate, returning iesBadActionData.MinVersionName of action to invoke, either in the engine or the handler DLL.The Signature_ represents a unique file signature and is also the foreign key in the Signature, RegLocator, IniLocator, CompLocator and the DrLocator tables.TextStyleColorLocalized description displayed in progress dialog and log when action is executing.FaceNameName of action to be described.SizeName of tableStyleBitsSet of values that are permittedOptional localized format template used to format action data records for display during action execution.Column to which foreign key connectsMinimum value allowedWhether the column is nullableMaximum value allowedDescription of columnFor foreign key, Name of table to which data must linkUITextIdentifierName of columnUpgradeActionPropertyText;Formatted;Template;Condition;Guid;Path;Version;Language;Identifier;Binary;UpperCase;LowerCase;Filename;Paths;AnyPath;WildCardFilename;RegPath;KeyFormatted;CustomSource;Property;Cabinet;Shortcut;URLNString categoryRemoveSetUpgradeCodeCategoryVersionMaxKeyColumnVersionMinKeyTableMinValue_ValidationMaxValueColumnMsiPatchOldAssemblyNameAssembly_MsiPatchOldAssemblyFileThe minimum ProductVersion of the products in this set. The set may or may not include products with this particular version.The maximum ProductVersion of the products in this set. The set may or may not include products with this particular version.The UpgradeCode GUID belonging to the products in this set.A comma-separated list of languages for either products in this set or products not in this set.The list of features to remove when uninstalling a product from this set. The default is "ALL".The attributes of this product set.The property to set when a product in this set is found.The localized version of the s pg}@  r 4{H  > r 5z   )    "  , #0#1T     #   "   , =  "  ?_anK< 067R>nfnsH  = !   # O?%c&s 9&!$.EvJA9>k :QR6@CeB).r[/qsQ|^:. NS7d f586=8 Dd{M.K;'s*('#7X0V/ O 5(  o B T   j$6 Z      ~~;``#8$3 1Y(X        !#! )_COMPLUS_PROGRESSTEXT_INSTALLUninstalling COM+ application: [1]IS_COMPLUS_PROGRESSTEXT_UNINSTALLCreating IIS virtual directory %sPROGMSG_IIS_CREATEVROOTCreating IIS virtual directories...PROGMSG_IIS_CREATEVROOTSExtracting information for IIS virtual directories...PROGMSG_IIS_EXTRACTExtracted information for IIS virtual directories...PROGMSG_IIS_EXTRACTDONERemoving web site at port %dPROGMSG_IIS_REMOVESITERemoving IIS virtual directory %sPROGMSG_IIS_REMOVEVROOTRemoving IIS virtual directories...PROGMSG_IIS_REMOVEVROOTSRolling back virtual directory and web site changes...PROGMSG_IIS_ROLLBACKVROOTSISSELFREG.DLL{C8AA5B6D-C6A6-487D-B2AD-B6C2DC258E47}{DF70A00D-3D0F-4C46-8879-F5F98E463F4C}[%SystemRoot]\Profiles\All Users[%ALLUSERSPROFILE][%USERPROFILE]Adobe Flash PlayerSOFTWARE\Microsoft\Active Setup\Installed Components\{D27CDB6E-AE6D-11CF-96B8-444553540000}Registry1.0C2CDBF2_1C80_4504_88D6_137CD018DE12application/x-shockwave-flashflashSOFTWARE\Microsoft\Windows\CurrentVersion\Internet Settings\Accepted DocumentsR                  1:  3   + #                       * ;*-/ .034 "!!#54!#6 && [.N./.. .a. ..             egistry1.52442A12_0334_40E2_BC90_E3BE2AD2E349SOFTWARERegistry12.0C2CDBF2_1C80_4504_88D6_137CD018DE12ENLocaleRegistry2.0C2CDBF2_1C80_4504_88D6_137CD018DE12Registry3.0C2CDBF2_1C80_4504_88D6_137CD018DE12ComponentIDRegistry4.0C2CDBF2_1C80_4504_88D6_137CD018DE12SOFTWARE\Microsoft\Internet Explorer\ActiveX Compatibility\{D27CDB6E-AE6D-11CF-96B8-444553540000}Registry5.0C2CDBF2_1C80_4504_88D6_137CD018DE120Compatibility FlagsRegistry6.0C2CDBF2_1C80_4504_88D6_137CD018DE12FlashPlayerVersionSOFTWARE\Macromedia\FlashPlayerRegistry7.0C2CDBF2_1C80_4504_88D6_137CD018DE12ArialArial8Arial9ArialBlue10ArialBlueStrike10Courier NewCourierNew8CourierNew9MS GothicMSGothic9MS Sans SerifMSSGreySerif8TahomaMSSWhiteSerif8MSSansBold8MSSansSerif8MSSansSerif9Tahoma10Tahoma8Tahoma9TahomaBold10TahomaBold8Times New RomanTimes8Times9TimesItalic12TimesItalicBlue10TimesRed16_5F7B924E_5CA3_444D_8BB9_D2861D50D805_FILTER_D2B8A662_599E_4274_9F50_27AEEF985512_FILTER.htm Custom Action Information

Custom Action Information

Action Name

ISSelfRegisterCosting

Type

1

Description

Extracts operations to a temporary file for self-registration.

Custom Action Information

Custom Action Information

Action Name

ISSelfRegisterFiles

Type

3073

Description

789;<>?@ABCOQRorA3333333   L!, ( @Vr"Q 7X_    !"#$%&'()*+,-./0123456789;<>?@ABCDE     :=::=̐ xș݅ 8\$|tЇr؎@XDԗpH䌂`(L l4ĉTP쓈ʙ ޅRꋶ'JsH* + VWY[\]_aceghjlnprtvwy{}VVVVVVVVV}gVVVhcrVvwVVVVVVVVVVVVVVVVVVVVVVV}UXZ\]^`bd|fikmoqsuxz~f|o : _ QRR6@C $8 7X_    !"#$%&'()*+,-./0123456%-YehtzT  &(09;=?CGKM!*.1246>AEIOQSUZ\^_aikmnpuw{}Q #+Wcfry'):<@DHLN)"/3)7BFRTV]`jj:<@~DFHLNT],RR    $ T7 *  ?  ' @B 333333333333300{{{{{{{{{{{{{0{{{{{{{{{{{{w{{{{{{{{{{{{x0{{{{{{{{{{{{{p00{{{{{{{{{{{{{00{{{{{{{{{{{{{0 0{{{{{{{{{{{{x00wwwwwwwwwwww0{{{{{{{{{{{{00{{{{{{{{{{{{0{{{{{{x{{{{x?f ( @Oh+'0$@\d     DavidHackernAdobe Flash Player#Contact: Your local administratorInstaller,MSI,DatabaseAdobe Flash PlayerAdobe Systems, Inc.)InstallShield 12 - Premier Edition 12.0@=U@=U@=U'{0E56E9F3-80FF-4AD0-8C15-51A545D8C126} Intel;1033

Registers self-registering files.

Custom Action Information

Custom Action Information

Action Name

ISSelfRegisterFinalize

Type

1

Description

Cleans up temporary file from self-registration.

Custom Action Information

Custom Action Information

Action Name

ISUnSelfRegisterFiles

Type

3073

Description

Unregisters self-registering files.

Custom Action Information

Custom Action Information

Action Name

UZl >)8bm>'U8bJ HD>8HD> 'g'R :\fOl ') ')' 8b8bCT%%%'''+++,,,---7788PPPPPPPPTTZZZZZZZZ``mmmmmmzz555666<<==????BBBBBQQQQQQaaaaabbbEEEEEEEEEVVVVVhhkkkkkkk{{{{{{{{{{ # ')'O ') ') ')8:8b >PU)>Zl 8b'>mU8b 8>DHJ>DH ' ')]'Rg f ')] ')]:\ff ')] ')]Ol ') ') '8b8b8bCRTVX[ ')]mf 8DHJbbl) EGIKMOQSVWY[])>lprtv qsuwy|}bYl    O 8b n n nnn n n nnnn nn n nnn nnnn n nn n nn nnnnn nn nnnn n nnn nn nnnnnnn nnnnnn nnnnn n n n nnnn nnnnnnnn n nnn n nnn nnn nnn n n n nnnn nnnnnn nnnnnn n nn nn n n n n nn nn n n n n nn nnnn nn nn nndd PHPmZPmTammXVR[mf8bJ HD)blE SMQKOIGVY[W])rvt>pl}y|wusq l HH&HHHHHH&&@HHHHHH@H&HHHH@@HHH2222H222H22H22H@HHH H222&HHHH@@H@@H@ HHHH@@2HHHH H&H  HHHH2 | AWt0 *H 01 0 +0g +7Y0W02 +70$ F0!0 +䨗- By !0<0p)48{̺0  *H 0_1 0 UUS10U VeriSign, Inc.1705U .Class 3 Public Primary Certification Authority0 960129000000Z 280801235959Z0_1 0 UUS10U VeriSign, Inc.1705U .Class 3 Public Primary Certification Authority00  *H 0\Y>

SetAllUsersProfileNT

Type

51

Description

Initializes the ALLUSERSPROFILE directory identifier for Windows NT 4.

Custom Action Information

Custom Action Information

Action Name

setAllUsersProfile2K

Type

51

Description

Initializes the ALLUSERSPROFILE directory identifier for Windows 2000 or later.

Custom Action Information

Custom Action Information

Action Name

setUserProfileNT

Type

51

Description

Initializes the USERPROFILE directory indentifier.

Generating script operations for action:AdvertiseCreating foldersFree space: [1]Binding executablesProperty: [1], Signature: [2]Searching for qualifying productsFile: [1]Computing space requirementsDeleting servicesFolder: [1]Publishing qualified componentsShortcut: [1]Creating duplicate filesService: [1]Searching for related applicationsCopying files to the networkInstalling ODBC componentsFound application: [1]Installing system catalogGenerateScriptCopying new filesFile: [1], Directory: [9], Size: [6]Validating installFile: [1], Directory: [9], Size: [6]Installing new servicesRemoving filesFile: [1], Dependencies: [2]InstallSFPCatalogFileEvaluating launch conditionsService: [2]Creating shortcutsMigrating feature states from related applicationsMoving filesApplication: [1]Patching filesUpdating component registrationFile: [1], Directory: [2], Size: [3]Publishing product featuresComponent ID: [1], Qualifier: [2]Publishing product informationFeature: [1]Registering class serversRegistering COM+ Applications and ComponentsRegistering extension serversClass ID: [1]Registering fontsAppId: [1]{{, AppType: [2], Users: [3], RSN: [4]}}Registering MIME infoExtension: [1]Registering productFont: [1]Registering program identifiersMIME Content Type: [1], Extension: [2]Registering userRegistering type librariesProgID: [1]Allocating registry spaceLibID: [1]Removing duplicated filesUpdating environment stringsFile: [1], Directory: [9]Removing applicationsName: [1], Value: [2], Action [3]Removing foldersApplication: [1], Command line: [2]Rolling back action:RemoveFilesRemoving INI file entriesRemoving ODBC componentsFile: [1], Section: [2], Key: [3], Value: [4]Removing system registry valuesRemoving shortcutsKey: [1], Name: [2]Registering modulesRemoving backup filesRollbackRemoving moved filesRollbackCleanupUnregistering modulesFile: [1], Folder: [2]Initializing ODBC directoriesStarting servicesStopping servicesUnpublishing Qualified ComponentsUnpublishing product informationUnmoveFilesUnpublishing product featuresUnregister class serversCreating IIS Virtual Roots...UnpublishProductUnregistering COM+ Applications and ComponentsUnregistering extension serversAppId: [1]{{, AppType: [2]}}Unregistering fontsUnregistering MIME infoUnregistering program identifiersUnregistering type librariesWriting INI file valuesWriting system registry valuesAdvertising applicationKey: [1], Name: [2], Value: [3]Removing IIS Virtual Roots...caCreateVRootshttp://www.adobe.com/go/flashplayer_support/caRemoveVRootsAppFileFLASH_INSTALLEDFLASH_INSTALLED <> 0FLASH_INSTALLED = 01ISCHECKFORPRODUCTUPDATESAllUsersApplicationUsersNoAgreeToLicenseChange_IsMaintenanceCloseRestartRestartManagerOptionsaIS_SQLSERVER_USERNAMEIS_SQLSERVER_AUTHENTICATIONTypicalSetupType_IsSetupTypeMinDisplay_IsBitmapDlg[1]ProductNameALLUSERShttp://www.adobe.comARPHELPLINKARPNOMODIFYARPPRODUCTICON.exeARPPRODUCTICONARPURLINFOABOUT30DWUSINTERVALCECCA75FE9CBA098D9ACE02FFEDB978FBEECA78F69BBE0B8CE8BA7CFE97CF0AFCEBCE08FD9ACDWUSLINKDefaultUIFontInstallShield for Windows InstallerDialogCaptionMinimalDisplayNameCustomDisplayNameMinimalThe InstallScript engine is missing from this machine. If available, please run ISScript.msi, or contact your support personnel for further assistance.DisplayNameTypicalSetupErrorErrorDialog100INSTALLLEVELCosting XML files...ISSCRIPT_VERSION_MISSINGISVROOT_PORT_NOCreating XML file %s...IS_PROGMSG_XML_COSTINGPerforming XML file changes...IS_PROGMSG_XML_CREATE_FILERemoving XML file %s...IS_PROGMSG_XML_FILESRolling back XML file changes...IS_PROGMSG_XML_REMOVE_FILEUpdating XML file %s...IS_PROGMSG_XML_ROLLBACK_FILESAdobe Systems, Inc.IS_PROGMSG_XML_UPDATE_FILEARInstallChoiceCreating application pool %sManufacturervoicewarmupxMsiLogging12345<###-%%%%%%%>@@@@@PIDTemplateCreating application Pools...PROGMSG_IIS_CREATEAPPPOOLCreating web service extensionPROGMSG_IIS_CREATEAPPPOOLSCreating web service extensions...PROGMSG_IIS_CREATEWEBSERVICEEXTENSIONRemoving application poolPROGMSG_IIS_CREATEWEBSERVICEEXTENSIONSRemoving application pools...PROGMSG_IIS_REMOVEAPPPOOLRemoving web service exten  ,, Z>MBbkJ( !    "$& 2 &! , 2 &  !# /!  .!,m      L #          "%&"%!&&(&        sionPROGMSG_IIS_REMOVEAPPPOOLSRemoving web service extensions...PROGMSG_IIS_REMOVEWEBSERVICEEXTENSIONRolling back application pools...PROGMSG_IIS_REMOVEWEBSERVICEEXTENSIONSRolling back web service extensions...PROGMSG_IIS_ROLLBACKAPPPOOLSAdobe Flash Player 9PROGMSG_IIS_ROLLBACKWEBSERVICEEXTENSIONS{8186E1B9-DDC6-45B6-B9EB-C28947CBC4CF}ProductCodenoneProductIDProductLanguageProductVersioninstallProgressType0ProgressType1installedProgressType2installsProgressType3YesRebootYesNoomusReinstallModeTextSHOWLAUNCHPROGRAMISACTIONPROP1SecureCustomProperties{42463807-970B-4257-BC95-5C348D61DF1C}NewBinary10NewBinary11NewBinary12NewBinary13NewBinary14NewBinary15NewBinary16NewBinary17NewBinary18NewBinary19NewBinary2NewBinary20NewBinary3NewBinary4NewBinary6NewBinary7NewBinary8NewBinary9SetAllUsers.dllNOT UpdateStartedDisableCancelUpdateStartedEnableBackDefaultFinishHideFinishText1ShowFinishText2RestContText1RestContText2ProgressType2="installed" And ((ACTION<>"INSTALL") OR (NOT ISENABLEDWUSFINISHDIALOG) OR (ISENABLEDWUSFINISHDIALOG And Installed))TextLine2ISENABLEDWUSFINISHDIALOG And NOT Installed And ACTION="INSTALL"CheckBoxUpdatesCheckForUpdatesTextSHOWLAUNCHPROGRAM="-1" And PROGRAMFILETOLAUNCHATEND <> "" And NOT Installed And NOT ISENABLEDWUSFINISHDIALOGCheckLaunchProgramSHOWLAUNCHREADME="-1" And READMEFILETOLAUNCHATEND <> "" And NOT Installed And NOT ISENABLEDWUSFINISHDIALOGCheckLaunchReadmeLaunchProgramTextLaunchReadmeTextProgressType2="uninstalled" And ((ACTION<>"INSTALL") OR (NOT ISENABLEDWUSFINISHDIALOG) OR (ISENABLEDWUSFINISHDIALOG And Installed))TextLine3UpdateTextLine1UpdateTextLine2UpdateTextLine3ProgressType2="installed"DlgDescProgressType1="Installing"DlgTitleProgressType3="installs"DlgTextProgressType1="Uninstalling"DlgTitle2ProgressType3="uninstalls"DlgText2ProgressType2="uninstalled"DlgDesc2ChangeFolderCustomSetupDetailsInstallLabelSERIALNUMSHOWSerialLabelCustomerInformationNOT PrivilegedDlgRadioGroupTextProductState > 0Version9XRadioGroupSerialNumberSHOWCOPYRIGHT="No"CopyrightSHOWCOPYRIGHT="Yes"AgreeToLicense <> "Yes"NextLicenseAgreementAgreeToLicense = "Yes"ProgressType0="Modify"ReadyToInstallProgressType0="Repair"ProgressType0="install"DlgTitle3IS_SQLSERVER_AUTHENTICATION=0lblPswdSQLLoginIS_SQLSERVER_AUTHENTICATION=1EdtLoginEdtPswdlblLoginIDRESUMEPreselectedTextNOT RESUMEResumeTextCancelSetupSpawnDialogAdminNetworkLocationNewDialogReturnEndDialog[Suspend]{}ExitOKISCHECKFORPRODUCTUPDATES="1" And ISENABLEDWUSFINISHDIALOG And NOT ISREBOOTREQUIRED And NOT Installed And ACTION="INSTALL"CheckForProductUpdatesDoActionISCHECKFORPRODUCTUPDATES="1" And ISENABLEDWUSFINISHDIALOG And ISREBOOTREQUIRED And NOT Installed And ACTION="INSTALL"CheckForProductUpdatesOnRebootLAUNCHPROGRAMIS_LAUNCH_MY_PROGRAM_PLEASEAdminChangeFolderResetDirectoryListUpUpDirectoryListNewNewFolderSetTargetPathOutOfNoRbDiskSpace <> 1InstallNowOutOfNoRbDiskSpace = 1OutOfSpaceBrowseCustomSetupTipsMaintenanceTypeCustom[_IsSetupTypeMin]InstallChangeFolderSelectionBrowseDiskSpaceRequirements(SERIALNUMVALRETRYLIMIT) And (SERIALNUMVALRETRYLIMIT<0) And (SERIALNUMVALRETURN<>SERIALNUMVALSUCCESSRETVAL)(Not SERIALNUMVALRETURN) OR (SERIALNUMVALRETURN=SERIALNUMVALSUCCESSRETVAL)ApplicationUsers = "AllUsers" And Privileged[ALLUSERS]ApplicationUsers = "OnlyCurrentUser" And PrivilegedDatabaseFolderDATABASEDIR[_BrowseProperty]DestinationFolderFilesInUseIgnoreRetry[ProgressType1] [ProgressType2][ProgressType3]SplashBitmap_IsMaintenance = "Change"_IsMaintenance = "Reinstall"_IsMaintenance = "Remove"ReadyToRemoveModifyingRepairingmodifiedrepairsmodifiesALLReinstall[ReinstallModeText]ReinstallModeModify[ProgressType0]RepairMsiRMFilesInUseRestartManagerOption="CloseRestart"RMShutdownAndRestartACTION = "ADMIN"ResumeACTION <> "ADMIN"PATCH And REINSTALL=""PATCH And REINSTALLMODE=""Installed OR _IsSetupTypeMin = "Custom"Installed AND _IsMaintenance = "Reinstall"NOT Installed AND _IsSetupTypeMin <> "Custom"RemoveNowuninstalleduninstallsSQLBrowse[IS_SQLSERVER_LIST][IS_SQLSERVER_SERVER]IS_SQLSERVER_STATUS=0ISSQLServerValidateBtnSQLBrowseISSQLServerListErrorYesErrorAbortAErrorCancelCErrorIgnoreIErrorNoErrorOkOErrorRetryR_IsSetupTypeMin = "Custom"_IsSetupTypeMin <> "Custom"_IsSetupTypeMin = "Typical"AddLocal[ISUpdateServiceFolder]FlashUtil.exe "/au[ProductCode] /EndOfInstall"[ISUpdateServiceFolder]FlashUtil.exe "/au[ProductCode] /EndOfInstall /Reboot"SetAllUsersf1ISSetup.dll[INSTALLDIR]ARPINSTALLLOCATION[INSTALLDIR]\FlashUtil9c.exeUnInstallerExeSource-uninstallUnlockError [1].Warning [1].Info [1].Internal Error [1]. [2]{, [3]}{, [4]}{{Disk full: }}Action [Time]: [1]. [2][ProductName]{[2]}{, [3]}{, [4]}Message type: [1], Argument: [2]=== Logging started: [Date] [Time] ====== Logging stopped: [Date] [Time] ===Action start [Time]: [1].Action ended [Time]: [1]. Return value [2].Time remaining: {[1] minutes }{[2] seconds}Out of memory. Shut down other applications before retrying.Installer is no longer responding.Installer terminated prematurely.Please wait while Windows configures [ProductName]Gathering required information...Removing older versions of this applicationPreparing to remove older versions of this application{[ProductName] }Setup completed successfully.{[ProductName] }Setup failed.Error reading from file: [2]. {{ System error [3].}} Verify that the file exists and that you can access it.Cannot create the file [3]. A directory with this name already exists. Cancel the installation and try installing to a different location.Please insert the disk: [2]The installer has insufficient privileges to access this directory: [2]. The installation cannot continue. Log on as an administrator or contact your system administrator.Error writing to file [2]. Verify that you have access to that directory.Error reading from file [2]. Verify that the file exists and that you can access it.Another application has exclusive access to the file [2]. Please shut down all other applications, then click Retry.There is not enough disk space to install the file [2]. Free some disk space and click Retry, or click Cancel to exit.Source file not found: [2]. Verify that the file exists and that you can acces &                    D  !    ?lk    (   &   Z $      ' $  /yu     # kJ, 3        #'*-        EM      %  ''++<"!2!+6-mJUuwTmba@&,Cs it.Error reading from file: [3]. {{ System error [2].}} Verify that the file exists and that you can access it.Error writing to file: [3]. {{ System error [2].}} Verify that you have access to that directory.Source file not found{{(cabinet)}}: [2]. Verify that the file exists and that you can access it.Cannot create the directory [2]. A file with this name already exists. Please rename or remove the file and click Retry, or click Cancel to exit.The volume [2] is currently unavailable. Please select another.The specified path [2] is unavailable.Unable to write to the specified folder [2].A network error occurred while attempting to read from the file [2]An error occurred while attempting to create the directory [2]A network error occurred while attempting to create the directory [2]A network error occurred while attempting to open the source file cabinet [2].The specified path is too long [2].The Installer has insufficient privileges to modify the file [2].A portion of the path [2] exceeds the length allowed by the system.The path [2] contains words that are not valid in folders.The path [2] contains an invalid character.[2] is not a valid short file name.Error getting file security: [3] GetLastError: [2]Invalid Drive: [2]Error applying patch to file [2]. It has probably been updated by other means, and can no longer be modified by this patch. For more information contact your patch vendor. {{System Error: [3]}}A file that is required cannot be installed because the cabinet file [2] is not digitally signed. This may indicate that the cabinet file is corrupt.A file that is required cannot be installed because the cabinet file [2] has an invalid digital signature. This may indicate that the cabinet file is corrupt.{ Error [3] was returned by WinVerifyTrust.}Failed to correctly copy [2] file: CRC error.Failed to correctly patch [2] file: CRC error.The file '[2]' cannot be installed because the file cannot be found in cabinet file '[3]'. This could indicate a network error, an error reading from the CD-ROM, or a problem with this package.The cabinet file '[2]' required for this installation is corrupt and cannot be used. This could indicate a network error, an error reading from the CD-ROM, or a problem with this package.There was an error creating a temporary file that is needed to complete this installation. Folder: [3]. System error code: [2]Could not create key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not open key: [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not delete value [2] from key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not delete key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not read value [2] from key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not write value [2] to key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not get value names for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not get sub key names for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not read security information for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not increase the available registry space. [2] KB of free registry space is required for the installation of this application.Another installation is in progress. You must complete that installation before continuing this one.Error accessing secured data. Please make sure the Windows Installer is configured properly and try the installation again.User [2] has previously initiated an installation for product [3]. That user will need to run that installation again before using that product. Your current installation will now continue.User [2] has previously initiated an installation for product [3]. That user will need to run that installation again before using that product.Out of disk space -- Volume: '[2]'; required space: [3] KB; available space: [4] KB. Free some disk space and retry.Are you sure you want to cancel?The file [2][3] is being held in use{ by the following process: Name: [4], ID: [5], Window Title: [6]}. Close that application and retry.The product [2] is already installed, preventing the installation of this product. The two products are incompatible.Out of disk space -- Volume: [2]; required space: [3] KB; available space: [4] KB. If rollback is disabled, enough space is available. Click Cancel to quit, Retry to check available disk space again, or Ignore to continue without rollback.Could not access network location [2].The following applications should be closed before continuing the installation:Could not find any previously installed compliant products on the machine for installing this product.An error occurred while applying security settings. [2] is not a valid user or group. This could be a problem with the package, or a problem connecting to a domain controller on the network. Check your network connection and click Retry, or Cancel to end the install. Unable to locate the user's SID, system error [3]Admin user failed to apply patch for a per-user managed or a per-machine application which is in advertise state.The key [2] is not valid. Verify that you entered the correct key.The installer must restart your system before configuration of [2] can continue. Click Yes to restart now or No if you plan to restart later.You must restart your system for the configuration changes made to [2] to take effect. Click Yes to restart now or No if you plan to restart later.An installation for [2] is currently suspended. You must undo the changes made by that installacLtion to continue. Do you want to undo those changes?A previous installation for this product is in progress. You must undo the changes made by that installation to continue. Do you want to undo those changes?No valid source could be found for product [2]. The Windows Installer cannot continue.Installation operation completed successfully.Installation operation failed.Product: [2] -- [3]You may either restore your computer to its previous state or continue the installation later. Would you like to restore?An error occurred while writing installation information to disk. Check to make sure enough disk space is available, and click Retry, or Cancel to end the installation.One or more of the files required to restore your computer to its previous state could not be found. Restoration will not be possible.[2] cannot install one of its required products. Contact your technical support group. {{System Error: [3].}}The older version of [2] cannot be removed. Contact your technical support group. {{System Error [3].}}Installed [2].Configured [2].Removed [2].File [2] was rejected by digital signature policy.Windows Installer service could not be accessed. Contact your support personnel to verify that it is properly registered and enabled.There is a problem with this Windows Installer package. A script required for this install to complete could not be run. Contact your support personnel or package vendor. Custom action [2] script error [3], [4]: [5] Line [6], Column [7], [8]There is a problem with this Windows Installer package. A program required for this install to complete could not be run. Contact your support personnel or package vendor. Action: [2], location: [3], command: [4]There is a problem with this Windows Installer package. A program run as part of the setup did not finish as expected. Contact your support personnel or package vendor. Action [2], location: [3], command: [4]There is a problem with this Windows Installer package. A DLL required for this install to complete could not be run. Contact your support personnel or package vendor. Action [2], entry: [3], library: [4]Removal completed successfully.Removal failed.Advertisement completed successfully.Advertisement failed.Configuration completed successfully.Configuration failed.You must be an Administrator to remove this application. To remove this application, you can log on as an administrator, or contact your technical support group for assistance.The source installation package for the product [2] is out of sync with the client package. Try the installation again using a valid copy of the installation package '[3]'.In order to complete the installation of [2], you must restart the computer. Other users are currently logged on to this computer, and restarting may cause them to lose their work. Do you want to restart now?The path [2] is not valid. Please specify a valid path.There is no disk in drive [2]. Please insert one and click Retry, or click Cancel to go back to the previously selected volume.There is no disk in drive [2]. Please insert one and click Retry, or click Cancel to return to the browse dialog and select a different volume.The folder [2] does not exist. Please enter a path to an existing folder.You have insufficient privileges to read this folder.A valid destination folder for the installation could not be determined.Error attempting to read from the source installation database: [2].Scheduling reboot operation: Renaming file [2] to [3]. Must reboot to complete operation.Scheduling reboot operation: Deleting file [2]. Must reboot to complete operation.Module [2] failed to register. HRESULT [3]. Contact your support personnel.Module [2] failed to unregister. HRESULT [3]. Contact your support personnel.Failed to cache package [2]. Error: [3]. Contact your support personnel.Could not register font [2]. Verify that you have sufficient permissions to install fonts, and that the system supports this font.Could not unregister font [2]. Verify that you have sufficient permissions to remove fonts.Could not create shortcut [2]. Verify that the destination folder exists and that you can access it.Could not remove shortcut [2]. Verify that the shortcut file exists and that you can access it.Could not register type library for file [2]. Contact your support personnel.Could not unregister type library for file [2]. Contact your support personnel.Could not update the INI file [2][3]. Verify that the file exists and that you can access it.Could not schedule file [2] to replace file [3] on reboot. Verify that you have write permissions to file [3].Error removing ODBC driver manager, ODBC error [2]: [3]. Contact your support personnel.Error installing ODBC driver manager, ODBC error [2]: [3]. Contact your support personnel.Error removing ODBC driver [4], ODBC error [2]: [3]. Verify that you have sufficient privileges to remove ODBC drivers.Error installing ODBC driver [4], ODBC error [2]: [3]. Verify that the file [4] exists and that you can access it.Error configuring ODBC data source [4], ODBC error [2]: [3]. Verify that the file [4] exists and that you can access it.Service [2] ([3]) failed to start. Verify that you have sufficient privileges to start system services.Service [2] ([3]) could not be stopped. Verify that you have sufficient privileges to stop system services.Service [2] ([3]) could not be deleted. Verify that you have sufficient privileges to remove system services.Service [2] ([3]) could not be installed. Verify that you have sufficient privileges to install system services.Could not update environment variable [2]. Verify tha@HA0C??(E8BA(H94I<@HAEFAE(?(E8BA(H JZ@HRDEC;;B&F7BB4FhD&B F@HRDEC??(E8BA(HTt you have sufficient privileges to modify environment variables.You do not have sufficient privileges to complete this installation for all users of the machine. Log on as an administrator and then retry this installation.Could not set file security for file [3]. Error: [2]. Verify that you have sufficient privileges to modify the security permissions for this file.Component Services (COM+ 1.0) are not installed on this computer. This installation requires Component Services in order to complete successfully. Component Services are available on Windows 2000.Error registering COM+ application. Contact your support personnel for more information.Error unregistering COM+ application. Contact your support personnel for more information.The description for service '[2]' ([3]) could not be changed.The Windows Installer service cannot update the system file [2] because the file is protected by Windows. You may need to update your operating system for this program to work correctly. {{Package version: [3], OS Protected version: [4]}}The Windows Installer service cannot update the protected Windows file [2]. {{Package version: [3], OS Protected version: [4], SFP Error: [5]}}This setup requires Internet Information Server 4.0 or higher for configuring IIS Virtual Roots. Please make sure that you have IIS 4.0 or higher.This setup requires Administrator privileges for configuring IIS Virtual Roots.An error occurred during the installation of assembly component [2]. HRESULT: [3]. {{assembly interface: [4], function: [5], assembly name: [6]}}An error occurred during the installation of assembly '[6]'. The assembly is not strongly named or is not signed with the minimal key length. HRESULT: [3]. {{assembly interface: [4], function: [5], component: [2]}}An error occurred during the installation of assembly '[6]'. The signature or catalog could not be verified or is not valid. HRESULT: [3]. {{assembly interface: [4], function: [5], component: [2]}}An error occurred during the installation of assembly '[6]'. One or more modules of the assembly could not be found. HRESULT: [3]. {{assembly interface: [4], function: [5], component: [2]}}Shortcuts not supported by the operating system.Invalid .ini action: [2]Could not resolve path for shell folder [2].Writing .ini file: [3]: System error: [2].Shortcut Creation [3] Failed. System error: [2].Shortcut Deletion [3] Failed. System error: [2].Error [3] registering type library [2].Error [3] unregistering type library [2].Section missing for .ini action.Key missing for .ini action.Detection of running applications failed, could not get performance data. Registered operation returned : [2].Detection of running applications failed, could not get performance index. Registered operation returned : [2].Detection of running applications failed.Database: [2]. Database object creation failed, mode = [3].Database: [2]. Initialization failed, out of memory.Database: [2]. Data access failed, out of memory.Database: [2]. Cannot open database file. System error [3].Database: [2]. Table already exists: [3].Database: [2]. Table does not exist: [3].Database: [2]. Table could not be dropped: [3].Database: [2]. Intent violation.Database: [2]. Insufficient parameters for Execute.Database: [2]. Cursor in invalid state.Database: [2]. Invalid update data type in column [3].Database: [2]. Could not create database table [3].Database: [2]. Database not in writable state.Database: [2]. Error saving database tables.Database: [2]. Error writing export file: [3].Database: [2]. Cannot open import file: [3].Database: [2]. Import file format error: [3], Line [4].Database: [2]. Wrong state to CreateOutputDatabase [3].Database: [2]. Table name not supplied.Database: [2]. Invalid Installer database format.Database: [2]. Invalid row/field data.Database: [2]. Code page conflict in import file: [3].Database: [2]. Transform or merge code page [3] differs from database code page [4].Database: [2]. Databases are the same. No transform generated.Database: [2]. GenerateTransform: Database corrupt. Table: [3].Database: [2]. Transform: Cannot transform a temporary table. Table: [3].Database: [2]. Transform failed.Database: [2]. Invalid identifier '[3]' in SQL query: [4].Database: [2]. Unknown table '[3]' in SQL query: [4].Database: [2]. Could not load table '[3]' in SQL query: [4].Database: [2]. Repeated table '[3]' in SQL query: [4].Database: [2]. Missing ')' in SQL query: [3].Database: [2]. Unexpected token '[3]' in SQL query: [4].Database: [2]. No columns in SELECT clause in SQL query: [3].Database: [2]. No columns in ORDER BY clause in SQL query: [3].Database: [2]. Column '[3]' not present or ambiguous in SQL query: [4].Database: [2]. Invalid operator '[3]' in SQL query: [4].Database: [2]. Invalid or missing query string: [3].Database: [2]. Missing FROM clause in SQL query: [3].Database: [2]. Insufficient values in INSERT SQL statement.Database: [2]. Missing update columns in UPDATE SQL statement.Database: [2]. Missing insert columns in INSERT SQL statement.Database: [2]. Column '[3]' repeated.Database: [2]. No primary columns defined for table creation.Database: [2]. Invalid type specifier '[3]' in SQL query [4].IStorage::Stat failed with error [3].Database: [2]. Invalid Installer transform format.Database: [2] Transform stream read/write failure.Database: [2] GenerateTransform/Merge: Column type in base table does not match reference table. Table: [3] Col #: [4].Database: [2] GenerateTransform: More columns in base table than in reference table. Table: [3].Database: [2] Transform: Cannot add existing row. Table: [3].Database: [2] Tran@H C5BErE<~;U=@HDDrDhD7H@H FE2DA7CrD@HB*CE5G B l@HBEEC(H @HD'F/BDDrDhDE @H?DDrDhD;EhD'B'H @H? FE2DA7CrDB)B5BA(HB@H?BoBB*H@HBExE(;2DD1BE6H3 column count differed in the '[3]' table of the two databases.Database: [2]. GenerateTransform/Merge: Column name in base table does not match reference table. Table: [3] Col #: [4].SummaryInformation write for transform failed.Database: [2]. MergeDatabase will not write any changes because the database is open read-only.Database: [2]. MergeDatabase: A reference to the base database was passed as the reference database.Database: [2]. MergeDatabase: Unable to write errors to Error table. Could be due to a non-nullable column in a predefined Error table.Database: [2]. Specified Modify [3] operation invalid for table joins.Database: [2]. Code page [3] not supported by the system.Database: [2]. Failed to save table [3].Database: [2]. Exceeded number of expressions limit of 32 in WHERE clause of SQL query: [3].Database: [2] Transform: Too many columns in base table [3].Database: [2]. Could not create column [3] for table [4].Could not rename stream [2]. System error: [3].Stream name invalid [2].Patch notify: [2] bytes patched to far.Error getting volume info. GetLastError: [2].Error getting disk free space. GetLastError: [2]. Volume: [3].Error waiting for patch thread. GetLastError: [2].Could not create thread for patch application. GetLastError: [2].Source file key name is null.Destination file name is null.Attempting to patch file [2] when patch already in progress.Attempting to continue patch when no patch is in progress.Missing path separator: [2].File does not exist: [2].Error setting file attribute: [3] GetLastError: [2].File not writable: [2].Error creating file: [2].User canceled.Invalid file attribute.Could not open file: [3] GetLastError: [2].Could not get file time for file: [3] GetLastError: [2].Error in FileToDosDateTime.Could not remove directory: [3] GetLastError: [2].Error getting file version info for file: [2].Error deleting file: [3]. GetLastError: [2].Error getting file attributes: [3]. GetLastError: [2].Error loading library [2] or finding entry point [3].Error getting file attributes. GetLastErr>EN#AC:+#2-.~d{u v&Of=qCW.yni 2%%8J5HDYRMOH[d_NP^oXZwrxhlnqwY[=O0,*00') no);41;))/ 3'63.,.,77'1&6T>?I :5<6-8=?G845;>>%==%22w`=K?MKSw5/$)/.-,.0HXx._dF9(\<9/'->2A<:4+82.,6511J!9,:8:<?2 or: [2].Error setting file attributes. GetLastError: [2].Error converting file time to local time for file: [3]. GetLastError: [2].Path: [2] is not a parent of [3].Error creating temp file on path: [3]. GetLastError: [2].Could not close file: [3] GetLastError: [2].Could not update resource for file: [3] GetLastError: [2].Could not set file time for file: [3] GetLastError: [2].Could not update resource for file: [3], Missing resource.Could not update resource for file: [3], Resource too large.Specified path is empty.Could not find required file IMAGEHLP.DLL to validate file:[2].[2]: File does not contain a valid checksum value.User ignore.Error attempting to read from cabinet stream.Copy resumed with different info.FDI server errorFile key '[2]' not found in cabinet '[3]'. The installation cannot continue.Could not initialize cabinet file server. The required file 'CABINET.DLL' may be missing.Not a cabinet.Cannot handle cabinet.Corrupt cabinet.Could not locate cabinet in stream: [2].Cannot set attributes.Error determining whether file is in-use: [3]. GetLastError: [2].Unable to create the target file - file may be in use.Progress tick.Need next cabinet.Folder not found: [2].Could not enumerate subfolders for folder: [2].Bad enumeration constant in CreateCopier call.Could not BindImage exe file [2].User failure.User abort.Failed to get network resource information. Error [2], network path [3]. Extended error: network provider [5], error code [4], error description [6].Invalid CRC checksum value for [2] file.{ Its header says [3] for checksum, its computed value is [4].}Could not apply patch to file [2]. GetLastError: [3].Patch file [2] is corrupt or of an invalid format. Attempting to patch file [3]. GetLastError: [4].File [2] is not a valid patch file.File [2] is not a valid destination file for patch file [3].Unknown patching error: [2].Cabinet not found.Error opening file for read: [3] GetLastError: [2].Error opening file for write: [3]. GetLastError: [2].Directory does not exist: [2].Drive not ready: [2].64-bit4M registry operation attempted on 32-bit operating system for key [2].Out of memory.Could not create rollback script enumerator.Called InstallFinalize when no install in progress.Called RunScript when not marked in progress.Invalid value for property [2]: '[3]'The [2] table entry '[3]' has no associated entry in the Media table.Duplicate table name [2].[2] Property undefined.Could not find server [2] in [3] or [4].Value of property [2] is not a valid full path: '[3]'.Media table not found or empty (required for installation of files).Could not create security descriptor for object. Error: '[2]'.Attempt to migrate product settings before initialization.The file [2] is marked as compressed, but the associated media entry does not specify a cabinet.Stream not found in '[2]' column. Primary key: '[3]'.RemoveExistingProducts action sequenced incorrectly.Could not access IStorage object from installation package.Skipped unregistration of Module [2] due to source resolution failure.Companion file [2] parent missing.Shared component [2] not found in Component table.Isolated application component [2] not found in Component table.Isolated components [2], [3] not part of same feature.Key file of isolated application component [2] not in File table.Resource DLL or Resource ID information for shortcut [2] set incorrectly.The depth of a feature exceeds the acceptable tree depth of [2] levels.A Feature table record ([2]) references a non-existent parent in the Attributes field.Property name for root source path not defined: [2      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  Pyu Ȉ Pyh0載YÐÐD$jP43D$jP3jh8dPd%D$(L$(D$3L$D$D$ D$T$,L$RD$$(D$PNL$d (Ðjh[dPd% $0L$D$3L$D$ D$D$L$$( h@L$Vhx@L$Hh`@L$:T$ R谂$$3d 0QVFPD$3FF F^YÐjh{dPd% $0L$D$3L$D$ D$D$L$$(T$ R $$3d 0 Pyu Ȉ Pyh0茇YÐSVW|$u3 PL!؋tjh@P% u _^[Ëjh@Q u _^[Ëjh@R u _^[Ëjh@P u _^[Ëjh@Q u _^[Ëjh@Vx u _^[Ëjh@DZPU _$^[ÐUjhdPd%SV\W3P3uDž\ u Džll3;lj}tH];t0S F6$VWjSjjf ujjW tBMjWQ ;t/}t&U RW tЅu EuW MPd _^[]S\$u[U- VWjjjSjjՋNVjT!t VWjSjjՍD$|$PL$QP!F_^]w$3[ø[ø[Ð \U$hVU u h@U, $hV-}^]\SW|$ V󫍄$lP2$p3+T$dT$d3@+уOʍT$d+O͍D$PL$$T$hQjjj jjjRj( _t,D$ jP$ 3ۋ[^]\h@Vt3ۋ[^]\djhPd%pSV$V u hAV, $V3ۃ;}^[$pd |;D$UW3|$8V󫍄$PL$/$L$3IT$|QRL$\$\$ \$$/@3T$!$I+‹;w|;vAL$S,1L$Ut+T$D$ξ@<ʃD$l$($3T$!I+‹;wB|;vCL$S,1L$UqMZ@ !L!This program cannot be run in DOS mode. $)(tmI'mI'mI'U'lI'U'zI'V'7I'V'`I'^k'oI'j'dI'mI'I'kj'eI'i'lI'RichmI'PELjD!  6w:h2x .textn `.rdataT  @@.dataL@@@@.reloc @Bt-T$D$΋$<ʃD$l$(D$_;]u!L$ T$0QRSSj SSSPS( tD$ jP$ \$L$ ;t1A:t |$t6?"u h$AV, W=0 VV |0"th$AV_^ÐVFtH@t ȈAUUU ][;ujT][E w;sj8SVt$W}ȋŃM_]^ ][D$Vt$FtH@t hDD$j L$$PQjVbpP,{ T$lPhBR׃D$hP$UL$D$QSVRptAUh(DD$j L$PQSVRoPz PD$phBP׃L$hQ3tVo$l_^][d hjhadPd%SUVW@3$)Ƅ$(f$<=d!P$,hFQ׋ R0ol$ D$$(P3QUDŽ$@\$ otVD$;tPnhET$j D$R$4PQU\$,nPy T$(PhBR׃D$$PL$SQntT$$8RhG$8L$PQL$lƄ$j$<Ƅ$T$D$h;D$L$L$UQ3%D$;u]VRT^^ L$ 3DYu_Huu 5uuL$Y;t VT^[ ÐSVWh H33ۋFtN+;sGRWmW FPjjjP hH_^[ÃVh@HpL$VD$j PQ^ PhGhGP ^(D$SUVL$8Wj PQ\^ T$$PhGhGRd!l$PP ~D$$WVPhGWVhGVӍWQhGVWUhGVӍ WRhpGVӍWPh|GVӋWL$j QR] PhdGVӋWD$j PQ] PhTGVӋWT$j RP\ Ph\GVӊ HGuTHWPhLGVӋ$WL$j QRI] Ph@GVWjjj_^][( SVWh(}\3҃;t@؉ $ \$T$ڋFN ~+\$ ;t +w;u3+;‰D$}3UR[؋FSWPL$QUiHVURWFNPQ7VR~QD$ N :TD$]V^_^[ Ë+sTWRPW+FL$ Q+׹+QP<N;t[T$ ;uF_F^[ PPPNA;tP;ljuO;t T$ ;uF_F^[ ÐAÐVWjaPD$ PjVLPVhQLPtVP_^L$3ɈHHH Qu3ËA+ÐSUVW|$FN V++l$t +wu3+D$}3RY^;߉D$tSUOF;uD$ PU7FNUQWTVFRPNQLO|$ T$΍F l$Llj~N_^][+sBOQPWF\$ й+S+QPN;tI;uBD$t$(t$,t$0tP $_^]d [ÐD$SUVW|$M33uuu IكvAM;t%Atnt-Et&ȈAUUU ][;uj脹][E w;sjhSVt$W}ȋŃM_]^ ][QD$ SUVt$WL$u ;AQ;+;+׋yT$;skfPEL$ffREf;tF;sCօt=D$ L$PQVC tT$+T:~T$럋L$_^Q]+[Y !_^][Y SًL$UCVWuL$;sq_^][ ;w_+L$;sK|$fPZDfQfMDf;uT$RWVB t;stNƋK_^]+[ !_^][ SVW|$v1F3;t*H:t#t;_H^^^ ^2[L$;uV:tA;t,H@:t_^Vt P ^ÐjhhdPd%SUVWl$EMu3ۋ;ˉ\$,D$tPD$PȋD$;u:N;u3QRkF uT$HF^ RFΉ@(;t$D$SPL$T$ QR19|$u܋FP%^^ L$35*uHuu 5uuL$*;t Vr%E;tH@:t F_^[L$d ÉvvL$_^[d ÐD$uH;t H;uÐjhdPd%QSUVt$ Wt$3;l$|$(nnn !QUW_W^D$kkk G !;s;u'QUjj_^][L$d 3;vU;uQG;u!xs?sss G;u!COKW S H_^]H[L$d jUt);!t{͋UȃL$_^][d ÐSUVL$WE;sQu3;tRFtK;|.NF;} HЋ;|:;΋t P;Pu9D$;u_^][YË˃@L$L$}+ŋq+‹T;} ;|;Ë| ;|;}֋׋\$Ë>9}~9|x;}x;|;v 8>뵋Ë++$;jSV! t$ VU +݃@$\$t$n@;ti;tbT$;|,~F;}/ω HЃ;|;֋t H;‰Hu;u\$;t97OG׋;} HЃ;|2;u_^][YÐ Pyu Ȉ Pyh0\YÐD$Ul$+ŋȃ@SVWT$}r+‹T;} ;|;Ë| ;|;}֋׋\$Ë>9}~9|x;}x;|;v 8>뵋Ë++$;jSV1 t$ VU +ŋЃ@$_^[]Ð Pyu Ȉ Pyh0,YÐ%!%!%!%|!%!%t!%p!%l!%x!%!%!%!%!%!%!%!t$Yø0EVjMEׅ!V|YPVM!eEPMEh0PE!^QQSVEWPuEu)]e~ jψ`5!jSoM!_^[d Au!UQMgEhP1PX/QVu!ejN MM^d VD$tVY^(QS]VWSuC e ~ jψ耄5!jSM!_^[d <yQVu!ejN 2M`M^d UQM*Eh0PHVD$tVY^Vt$!!^P0EVjME諃"VPYPVMeEPMEh2PE"^dQVu!ejN JMxM^d UQM*Eh2P`VD$tVY^Vt$9"^UE S]VW9CsCM +9usu;u5!Vu jyv?;u;Cu!xs)jrCu!GKOK O @6jV蘂t(Cu!M VPwG w$0_^[] SVt$ W9ws7蹑G\$+;s؅v2O+PPQw +jVt Gw$_^[Pyu PyQyu Qy h0>Yh2YáuSVWj_;uhuZuu5jhu uS h5Y=u%;u=u=uu j 9=uuS _^[jhu u hu Ã=uu hu Vi5ԌԌY Ќ+;s=RP5Ԍ] u3, Ќ+ ԌԌ ЌD$Ќ^t$yYHhYԌu jԌY ԌЌUQSVWE EddE] cm_^[XY$XY$UQQSVWdEEju uuwE @$M Ad]d_^[USVWE3PPPuuuu u| E_^[E]UE eMEEEB@MEdE썅duQuM$ȋEdUE jPppjup u ]U4SVWeEEEE EEEE EeeeeEemdE؍dEEEЋEEԍEPE0k$PhYYe}td]؉d EdE_^[USVWE@ftE @$jXMjE pE pE pjuE p u E x$u uu ] ck cjX_^[]UQSV} W}w _ƉuE|9u$MN9L};H~u EM Eu} }ʋEMF1M;G w;v$_^[USVWUjjh(ut]_^[]ËL$AtD$T$SVWD$Pjh0d5d%D$ Xp t.;t$$t(4v L$H |uhD@Td _^[3d y0uQ R 9QuSQH SQHMKCk Y[Q=L$r-=s+ȋą@Pjt$YYU} u }}jj juu uE ]U}M SVWt u-Au3uƋ3u vW0Awڀ!IIG;r_^[]U3} u9E}jXPuu uE ]UWVu M};v;xur)$8Ǻr $P$H$̟`#ъFGFGr$8I#ъFGr$8#ъFGr$8I/ DDDDDDDDDDDDDD$8HP\pE^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $С$IǺr +$ؠ$С0F#шGNOr$СIF#шGFGr$СF#шGFGFGZ$СIǡDDDDDDDDD D DDDD$С E^_ÐFGE^_ÍIFGFGE^_ÐFGFGFGE^_̋D$ StJT$3ۊ\$ t B2tlHt.urWߋ_t B2t>Hu[Ãr 3˿~3σtJ2t#2t2t 2t_B[ÍB_[ÍB_[ÍB_[U =SVWuu u^'YYlj u YMFEAEfAEMtW9u3kjE5jPjuS5Č$ uf}f}fEEEu ffFEu tS>u3ajE5jPjuS5Č$ ufuuCfufEE E$<uff;uft-u MjYjf;YH jY3_^[SUVW|$= M~jP&YY KAtG7G-t+u7G3ۃ= M~ jVY&YY Kpt \F7Gσ-u_^][t$lYÃ|$ SUVW8=ut$t$t$& jRL$ l$T$YfBtG u3T3Bًf;=rf;=w=1f;=r(f;=w=$<uffEEtHMu3T3Eًf;5rf;5w51f;5r(f;5w5$<uff;u$ftD$L$jY3_^][jYf;HS39vuD$f=ar]f=zwW[VWV 9= tVjYj[t$YD$t j%YVfD$_^[UQEf=uf Ã=vuf=arTf=zwNf=sjP (YYufEjEjPEjPh5v%fEtfEVt$WF @tf V(VV) _^Vt$WF t4Vs*V*v*) }Ft PfYf _^UVuS(uuu uu(^]UQSVW} }]υ}Mu3ufF tFE EMfF t*Ft#;ȋrW6SU)})~> ߋ}K;Mr.}t 3u+PSv]+ t6t7)EVh*Yt(FCME}vE_^[ÃN N 3+Eu V.u^WVt$t$t$'-Vq'_^j@t$ t$ ËD$ ju6Yt3;u,9 u~ u9 $vuI=0<6 uQYjX US]Vu W}u =u&tu"t WVSЅt WVSu3NWVS6E u u7WPStu&WVSu!E } ttWVSЉE E _^[] ut u=uur6t$6hHYYUjh("hdPd%SVWutyu;j ~YeV7YEt VP8YYM}Qj YÃuSj >YEEPEPVD E܅tPuu6E M }uu j UYVj5pyT Md _^[VD$tVUY^VW|$ D"7@PAYFYt 7PIYYF_^VW|$ D"GFt%w@PYFYtwPhIYYGF_^yD"t qYËAuL"Vjd"vYtV3YjIY^VD$tVfY^̋L$tAt@u~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+jPdPD$ d%l$ l$ PU EVWjYh"}EE EEPuuu _^UWVu M};v;xur)$Ǻr $$$ Lp#ъFGFGr$I#ъFGr$#ъFGr$IܮԮ̮ĮDDDDDDDDDDDDDD$0E^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $$@IǺr +$$ȯF#шGNOr$IF#шGFGr$F#шGFGFGZ$IDLT\dltDDDDDDDDD D DDDD$̰E^_ÐFGE^_ÍIFGFGE^_ÐFGFGFGE^_á،th@@h,@h(@h@jjt$  jjj Wj_9=(vut$ P |$ S\$=$v vu<Ԍt" ЌVq;rtЃ;5Ԍs^hL@hD@CYYhX@hP@2YY[t_t$=(v _j Yj YVt$;t$ s tЃ^Ujh"hdPd%(SVW]3;uu Yu ;u SYty9}܃j Y}S0YE;;5lywLVSPn8 t]8V3YE;t*CHE;rPSuS.0ESPO09}uK;uj^u u VW5pyX E;t#CHE;rPSuSu/MZ9}u";uj^u VSW5py E܋E;9=wVDYu ]3j VYÃGw;vj^u }܃j YEEPEPSw< }Ѕ;5qs\SWuu@tEE8S<YE܅t*E;rPuunWuu`<]}uSVj5pyX E܅t=E;rPSu'Wuu<VSj5py E܃M&E;uf9=wt^VBYKu ]j Y33w;uj^VSW5py ;u9=wt VlBYu3Md _^[Ujh"hdPd%SVWtyuFj $YeuV-YEt v uuM }Uuj HYÃuFj YEEPEPu: E؅t 0uuM-}uuj5py ƋMd _^[Ëuj Y5wt$YYÃ|$w"t$Yu9D$tt$2AYu3Ujh"hdPd% SVWtyuCu;5lyj YeV/YEM Etmj  YÃuZEtpj^u;5qw.j YEP9YEM Eu-Vuj YËEujX$Pj5pyX Md _^[UVuW 9>tI E@ft~to}uijVuu V~ tP8csmu,9xv'HItU$Ru uVuuu Pу u uu$Vuuu P jX_^]UE e@E|M;A| SVucsmW 9K~ub9~u]~uW xl&pl@pjVEE2?YYu= 9~u9~u ~u 9~9~}EPEPWu u؋E;E9;|;{wCEC E~dF@ xE~v7u= uM9EME}$uu$u S7uuuuu V ,}Ei}t jVqYY_^[À}u u$u uuuuu V UQQVWxht!u$u uuuu uus}EPEPWu uE;EsO;>|C;~>F NHtyu&ju$u VjPuuuu u ,E_^VW|$ GtJxPtAt$N;tQR#<YYu"ttD$tt t u3jX_^Ujh"hdPd% SVWe]su};utU~;w|eGDt hSPpMu/YËeM}]uG4u릉sMd _^[ËD$8csmt3U} S]VW} tu SWu},uuWu,u$6uuWFhu(@Gs uuWu,tWPN_^[]Ujh"hdPd%SVWe]]ԃeu FE5@lE*@pE}xlMHpeEu uSuVEԃeM:EԋMd _^[unYËeejEPYY3ϋu }E؉FMHlMHp?csmu)u# u}u}tPWYYËD$8csmuxux u xujX3Ujh"hdPd% SVWeMAuxkA`U | etDujv:YY0jW$:YYFMQPYYutR]js9YYjW9YYvsW ~V뗃~]jsu:v9YYjW9YYt~vVsYYPW f<9YYtVjWJ9YYtHvX9Yt;tjFPsYYPvWFPsYYPvWMMd _^[jXËeqUjh#hdPd%QQSVWeEtHIteQp1MMd _^[38E Ëe L$Vt$Qƅ| 42I ^USQE EEUuMm:VW_^]MUuQ]Y[ V# 0It:jtj8YYt)V50I tV4Y NjX^3^0ItP  0IËD$@Pq@VW!50I!u?jtj}7YYt&V50I tVY NjYW!_^á0IVt$u P!tlF$tPYF(tPYF0tPYF8tPYF@tPYFDtPYFP=qtPYVYj50I ^Ujh#hdPd%QQSVWe3u9p`tEP`u jXËeeMw7Ujh0#hdPd%QQSVWee4ItEjXËeeMISVD$ uL$D$3؋D$ Aȋ\$T$D$ ud$ȋD$r;T$wr;D$ vN3ҋ^[SD$ uL$D$ 3D$3Pȋ\$T$ D$ ud$d$r;T$ wr;D$v+D$T$+D$T$ ؃[V5 5I5tI5dI5DI^VW= @It+It#tItdItDIt P6rYJ|5dI5tI5I5DI_^UEV<@I4@Iu>WjvYujYj>YWu  >Yj Y_6 ^]UE4@I ]USVWjzuY;Y]u3pV3ҸJ9tt0B=J|EPS !j^;!j@%ČY39u󫪉}MA;@ej@Y34RJ;t,Qt%;wUJ@;vAA9uE}rEP JYČRAAyGƀ@=rSYČ5%3=vtjFY_^[ËD$%vuv%!uv%!uvvËD$-t"t t Ht3øøøøWj@Y33Č_UEVP5 !3@;rEƅ t7SWU ;w+ȍA ˃BBBu_[j5Č5PVPjU2j5VPVPV5Čj5VPVPh5Č\3ftt 〠@AA;rI3ArZwȀ arzw Ȁ @;r^Ã=̌ujY̌UjhP#hdPd%SVWe39=vuFWWj[ShL#VW !tv"WWShH#VW!"v9}~uuYYEvuuuuuu u!9} uvE WWuuE$@Pu  ؉];}$ eĉE܃MjXËe3}܃M]9}tfSuuuju  tMWWSuu u !u;t2E t@9};uuuSuu u !3eȋMd _^[E6$Ve܉]MjXËe33ۃMu;tVSuuu u !t9}WWuWWuuVSh u !;qlT$D$VJt 8t@Iu8^u+D$ËUWVSu }vxu; t.F'G8t,A<ɀ A,A<ɀ A8tx=j j$3ې t'FG8tPS/؃/8tX u  j[^_UQEHw KARV5KDV^teMEj eEjXM jjjQPEPj-uE #E ̋D$L$ ȋL$ u D$S؋D$d$؋D$[UWVSM u} vxuNAZ I& t! tFG8r8w8r8w8u Iu38=j j$33ۋ t# tFGQPS-؃-Y;u Iu3;t rX u jˋ[^_Ujhh#hdPd%SVWe395vuFVVj[ShL#WV !tv"VVShH#WV!v9u~uuYYEvuuuuuu u !E:9u uvE VVVVuuh u !E; u$'eĉE jXËe3uM9uVVuuuuh u !VVuuu u!};E$e܉]܃MjXËe33ۃM};t`WSuuu u!tHE tE;t7;|PSu, "9uuVVuuWSju  ;t3eȋMd _^[ËT$D$VJtf8t @@Iuf8^u+D$ËUQf}t4f}sE KfA#jEjPEjPj%.u3ËEM #áVj^u;}ƣjP`(YzYu!jV5G(YzYujY3ɸ0Nz =P|3ɺ@N4ytu AN|^H= vt/ËD$0N;r=Pw+P@Yà P ËD$} P!YËD$ P ËD$0N;r=Pw+POYà P ËD$} P0YËD$ P Vt$;5zs8΋ yDtWV1V(V1 _^/ / ^Vt$WV,1Yt<tuj1j 1Y;YtV1YP u !3Vc0ƃYy dt W.Y3_^Vt$F ttv ff 3YFF^Vt$V#Yt^F @tv*1Y^3^SVt$ 3WF ȃu7ft1F>+~&WPv1 ;uF t$F N Ff_^[jYSVWj333Y95~tzt_@ tYPVzYYH t0|$uPYtC|$utPYu z4VYYF;5|j|$Yt_^[Vt$F @t F f F u Vb2YFvvv FtotjV ‚u7NWtuN@u NNC|5z$!_^[SVWyt7;s!_ {tS $$;r6p&Yz|_^[S39̌VWuV5u3:t<=tGV5YtPqY;5vuj Y=u8t9UWYE?=t"U<;Yuj YW6YY8u]5uYu_^Ȍ[UQQS39̌VWuvhVS4!܌5v8tEPEPSSWMEMP;ujYEPEPEPVWEH5v_^u[UMESV!uW} Et7} 8"uDP@"t)t%t tF@tՊFt&F8"uF@CtF@t tF@ t t ūuHtfe8 t u@8t7} UE3ۀ8\u@C8"u,u%39}t x"Pu}} 39U‰UKtCt\FKutJ}u t? t:}t.ttF@Ft@@Xt&Ft'E_^[]QQwSU-D!VW333;u3Ջ;t w(@!;w;u Ջ;f9t@@f9u@@f9u+Ƌ=!SS@SSPVSSD$4׋;t2U ;YD$t#SSUPt$$VSSׅut$Y\$\$Vj,P+Y;Yt0@8t9;uA8uj SP8) tttEP}Y[3j9D$hP pyt6tyu h^Y u u5py 3jXátyVWufS39dyU-T ~@hy= p h@h6hj6vj5pyՃC;dy|5hyj5py]['u"hQFthjP 6;u5py _^jX ut u*=uu!hwYthYUU3ɸP;t A=hQ|V;Puu =u\hPj4!u\h&PYY\WP\@Yu;`yuM; Xyu%`yMB_^[ády TyVW3;u0DPP5hyW5py ;taTyhydy hyhAj5py4X ;ljFt*jh hW ;ljF uvW5pyT 3N>~dyF_^UQMSVWqA3ۅ|Cj?iZ0DE@@Jujy hhW up;wtƍ4;sCu0jX^;uCF;sN;Euq )u 9U }ƍ4;urq;s~;Esvu@j^X;u%C@;]s +q aq16;s)E 9U r4맍;]s +‰A aAFk+3_^[UQUS] V W}e+G ;M|vE+ȈG`seE4;rU;s 8u@;uBE;w+;v';s338u@<tC cC+MEE_^[VC20XC00USVWU] E@EEEECs {ta v|tEVUkT]^] t3x<{SkVS vjD虨C T{ v4롸UkjS֧]]_^[]UL$)APAP豧]W|$j$L$WtAt;u~Ѓ3ƒtAt#ttt͍y yyyL$ tAtdGu~Ѓ3‹tt4t'ttljD$_fD$G_fD$_ÈD$_ËT$L$u<:u. t&:au% t:Au t:au uҋ3Ð@ËtB:uA ttf:u t:au tVt$8csmuxux uwtPYt Vw3^h$ w5w áwtt$ЅYtjX3Vj^t$ t$  t3^Vj^t$ t$  t3^Vj^t$ t3^Ujh&hdPd%SVWuu u uw3;uj^u 3ۉ]tyuA};=lyw|j $Y]WYEM9]t^uH3ۋu j XYÃuA;5qw9j YEP7YEML9]tVSuH 9]u>Vj5pyX E9]u'9wtVY03ۋu j YËEMd _^[j *jYYj˷Ujh&hdPd%SVWew3;u>EPj^VhL#Vx tEPVhH#VS| jXwu$E;uvuuu uP| 9]uvESSuu E @Pu E;tc]<ǃ$գeuWSV jXËe33M;t)uVuu ju ;tuPVux 3e̋Md _^[UQ=vSVWuEAZ ]j;^}%95 M~ VSEYY KX#ƅueKDJte jE] X e ]VjMjQPEPW5v t;uE EM _^[̋L$ WtzVSًt$|$uuo!FGIt%t)uuQt FGt/KuD$[^_tGIuulGKu[^D$_ÉIt~Ѓ3‹tބt,tt uƉ3҉3It 3IuuD$[^_UV3PPPPPPPPU I tB$uA tF$s ^UWVSM&ً}3ˋu F3:GwtIIы[^_UV3PPPPPPPPU I tB$u t F$sF ^̋T$ L$tG3D$Wr-كt+шGIuʃttGJuD$_ËD$Ujh&hdPd%SVWePx3;u>EPj^VhL#Vx tEPVhH#VW| JjXPxuuuu ux (9}uvEWWWWuu h u!u;}$赟eĉEVWP MjXËe3}ԃMu9}WWVuuu h u!ED6$Ie܉] jXËe33ۃM;tUE;uvM< 4ffNSuuuP| Ef~tf>uWSuϟ E3eȋMd _^[SWj3BYj_9=~]VztA@ t PڧYtC|)z P z40zY$G;=|^j3Y_[VvL$3 r;t"F=s|r"$wB ^5 $r^Árw ^^ QQSUVWj73Y\$\$yu;stFuD~u#j~Yu F P FjEY^ S FtS \$E$륃+Ej$Y|$um\$D$ Cz\$^NVYt>z y;s``@ $WOYjY_^][YYËL$V; zWsUt/t;t#EEE t u#Muj^@t Mt t th؃;uHF *jVuEPuuu ;u!PYV,!u V ؃uM@ uMVSYYMt }w u,9uv'6E"tME$ƉEtEEtE؉EE E t83_^[̍B[Í$d$3D$ST$t B8tфtQu WV ؋ ~333ƃu%t%uu^_[3ËB8t6t8t't8tt8tt^_B[ÍB^_[ÍB^_[ÍB^_[̋L$WSV|$tiqtOL$F8tt F8t u^[_3ÊF8u~at(8uĊAtf8t3^[_G^[_Ë^[_S39XxVWuBh'8 ;tg5 h'WօXxtPh&Wh&W\x֣`x\xtЋ؅t`xtSЋt$t$t$SXx_^[3U EeHSVHWtgHHtFtAt<t*tHtFlxlxBhxhx5pxpx(ŲvPuYYdxdxjE͵uYu}SY3;u9MtjYjEt tuVTUNTuIVXFXUu7 r r;}(IVP dr= rA;|}tj}Y}u vXjYYuӃ} Yt}uE}FTuEFX3_^[ËT$ rVt$9rWt@DdhGetLastActivePopupGetActiveWindowMessageBoxAuser32.dllH:mm:ssdddd, MMMM dd, yyyyM/d/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDechHHH((((H((()H)H8)((P)H`)()hH)H))H)  *0 H*P p*p * * **+ @+ +  +@KV ++p,+ @,`,x,, ,,,P/ - (-(3 > I T _ju -  8. !,7BMXcny . . / P/ x/08@ /` //0q 00 `0hH HlH?00p0ɕ0 1 810p0@1 1  1  14H'10p01 82H `2\2@6 D4Z6d!46!,46L!L46l!444444455.5D5V5b5n5z555555555 66*6:p:\:L:::(:::9999999z9f9666667*767N7f7x777777777 88"828@8P8\8f8r888888889949L9N621ut|gyIx6f6,CloseHandleJCreateFileAFreeLibraryGetProcAddress/LoadLibraryExA0LoadLibraryExWQMultiByteToWideCharlstrlenAGetVersionExAeWaitForSingleObject\CreateProcessAlstrcpyAlstrcatAReadFile.LoadLibraryAlstrcpynAxDeleteFileAGetTempFileNameAGetTempPathAlstrcmpA{WritePrivateProfileStringAHeapFreeHeapAllocGetProcessHeapMGetFileSizeHGetFileAttributesAKERNEL32.dllwsprintfAUSER32.dllOleUninitializeOleInitializeole32.dllOLEAUT32.dllmsi.dllEnterCriticalSection)SleepInitializeCriticalSectionInterlockedExchangevDeleteCriticalSection-LeaveCriticalSectionRtlUnwindInterlockedDecrement InterlockedIncrementGetCommandLineAGetVersionRaiseExceptionExitProcess1TerminateProcess/GetCurrentProcessHeapReAllocHeapSize2GetCurrentThreadId9TlsSetValue6TlsAlloc7TlsFreeSetLastError8TlsGetValueZGetLastErrorGetCPInfoGetACP|GetOEMCPiWideCharToMultiByte LCMapStringA!LCMapStringWSetHandleCountGetStdHandlePGetFileTypeGetStartupInfoAeGetModuleFileNameAFreeEnvironmentStringsAFreeEnvironmentStringsW?GetEnvironmentStringsAGetEnvironmentStringsWgGetModuleHandleABGetEnvironmentVariableAHeapDestroyHeapCreateXVirtualFreevWriteFileUVirtualAllocIsBadWritePtrSetUnhandledExceptionFilterIsBadReadPtrIsBadCodePtrGetStringTypeAGetStringTypeW SetStdHandleFlushFileBuffersSetFilePointerSetEndOfFilejD::::@`:;';>;ISRegSvr.dllISSelfRegisterCostingISSelfRegisterFilesISSelfRegisterFinalizeISUnSelfRegisterFiles0*0P2`tlj{ISSelfRegisterFinalizeISUnSelfRegisterFilesISSelfRegisterFilesaxcpldllexeocxolbtlb /regserverDllRegisterServer /unregserverDllUnregisterServer"Finished Costing Process...Comitting Property Bag...|RegistrationCosting::CostAllISSelfRegEntries::MsiRecordGetString(hRecord,4,szCmdLine,&dwBuff)RegistrationCosting::CostAllISSelfRegEntries::MsiRecordGetString(hRecord,1,szFileKey,&dwBuff)Reading SelfRegItems from table, and perform costing...Initializing Property Bag...RegistrationCosting::CostAllISSelfRegEntries::MsiViewExecute(hView,NULL)%s : %sRegistrationCosting::CostAllISSelfRegEntries::MsiDatabaseOpenView(hDatabase,_T("Select * from ISSelfReg"),&hView)Select * from ISSelfRegISSelfReg table does not exist...skippingISSelfRegBeginning Costing Process...RegistrationCosting::GetComponentAction::MsiGetComponentState(m_hInstall,szComponent,&pInstallState,&pActionState)RegistrationCosting::GetFullPath::MsiFormatRecord(m_hInstall,hRec,szFullPath,&dwBuff)RegistrationCosting::GetFullPath::MsiRecordSetString(hRec,0,szFormat)[#%s]RegistrationCosting::GetComponentName::MsiRecordGetString(hRecord,2,szComponent,&dwBuff)RegistrationCosting::GetComponentName::MsiViewFetch(hView,&hRecord)RegistrationCosting::GetComponentName::MsiViewExecute(hView,NULL)RegistrationCosting::GetComponentName::MsiDatabaseOpenView(hDatabase,szSQL,&hView)SELECT * FROM File Where File='%s'RegistrationCosting::SetCustomActionData::MsiSetProperty(m_hInstall,szCustomActionName,rpg.IniFilePath())Setting Costing Info Location %s : %sCustomActionDataUnRegisterTypeLiboleaut32.dll.olb.tlb.ocx.exe.dll~Sorting Based On Order...HRESULTYesFailedCostOrderActionStateRegCmdLineUnRegCmdLineComponentFullPathFileKey%s%sFile Count : 0CountKeyListGetting file count from property bagFinished Comitting Property BagBegin Comitting Property BagWrite KeyList countNo rd".?AVexception@@d".?AVlogic_error@std@@d".?AVlength_error@std@@d".?AVout_of_range@std@@ d".?AVtype_info@@$$X0v`vxvHv`y!@~ڣ @ڣ AϢ[@~QQ^ _j21~ K K ((((( H .CCCzz &% % %h%8%%$$$P$$#x#y#z#`H#hQhQQQhQ x         ! 5A CPR S WY l m pr   )    s<(8(4(0(,((($((( (('''''''''''''''''''''|'t'h'`'T'H'D'@'8'$''.HtxxxxxxxxxPtpPSTPDTtt;Zx0Nm:Yw/Ml00!000=1K1Y1122@2Q2t22222343S33334 434K4f44444555 5$5(5B5K5R55?6Q6d66666R7b777;8T8e8888899l9;<<<<<=$=;=b=======>->M>>>%??? ?0Z00000L1R1i1112y2223K3U3|3334S4444"5L5m5556F6666'7 88899::::,;I;;;;&<<=t====>'>^>d>n>v>|>>>Q?k?????004000001:11R2`2q22223"383333L4j44E5x555556*61666677789#969=9:7:h:4;l;;;;;<>_> ?t?{?????@00:0?0E0s0x0000000001$1D1T1[1b11 6h6o6w6}66m7}77!8O8z89B9O999::::::7;M;;;;;;4J>>>M?PlI0m000 1>11n333333324f444D5X5h5556r666y777778899::;;<<<H??`t$01F2334455766$777-88888q999::: :<:::-;3;;;A;s;;;<<>>>>x??????ppy00512 3q3w33334_4444E55556 6'6M6666-7J7o777799M:j:::::<<*===3>?>c>?[??l&00114223z33(44U55556 66696666g770888Q99=::;E;;;;;;;<<<<=X=s==`?b2p22333333333333334 4444,4J4s4{444444 55&5m555556M6X6v66666757o7777v88888888888888 999"9+989>9H9N9U9]9c9p9{99999999:::":}:;w;;=]====(?@?G?O?T?X?\????????????2080<0@0D000000001+1]1d1h1l1p1t1x1|11111112%3?3N3333334 4t44445O5l5u5}55555555555666!6f6666662739:9I9Q9\9b9h9r99999999:$::::::::;;;<_>>>>>E>k>>>>>>>>>>>>>??j?u????????0$0(0,0004080<0@00000000011=1I1P1`1f1m1w11111111 22Q2222N3T3h33_4e444455585=5V555"6d6i6666A7G7::;;)=.=>>????@ 0&02080E0U0[0c000000041L1R1^1c111122333"3'333;3C3K3a3i3q3y33333333494F4S4f4o4{4444445 5+50585O5d5j5r5z55555555516;6@6E6J6c6i6666 7 757S7a7n7~7777777778+888B8L8T8b88888-9C9v99:^:::: ;4;C;;T0>>>4?m?????????? 00-060R0u0000000e1o11}222223334|44445516~777778 88#808588888889@9J9k99999 :: :A:f:u:::: ;;;3;A;N;S;Y;;;Y>>>>%?+?d??0070F0i0o0{0000000000 111)181J1p1}111111!252S2_2{22222222222223U5c5i55555555555556#6)64696B6G6W6]66G749?9G9Z9`9v9}999999999999]:= >>>.>e>o>w>}>>>>?#?.?4?P?V?`?f???????B0\00001110222H7^7k7q7v7}77777777K8Y88888M9R9n999999999:d:v:::::/;~=========>->>>?N?V?????????_000001!1m1|111112:2g2{2222233+3;3m3w333E4425J5_556$6I6678848?8m8^9v9:2:J:]:<<<<<<<<<<<==b=g=o=t=|====*>/>L>R>>??p0-050;0A000001`111#2*2029222 393\3|3333 4,4b4|44445566677I7i7777788)8=8Q8e8 11111111222 202<2@2D2H2`2d22222222222223 33 3(3,383@3D3T3X3`3d3l3p3x3|366666666888888888999,90989P9T9X9l9|99999999999:$:0:L:X:t:::::::;;(;D;L;T;\;h;;;;;;;;;<<(<0 >> ><>D>L>T>\>d>l>t>|>>>>>>>>>>??$?,?8?T?`?|????????0` 0040<0H0d0l0t0000000000001 1<1D1H1T1\1h11111111122 22 2<2H2d2@H00 00000 0$0004080<0H0T0h8888889 949D9d9t99;;0>8>P4000001 111$1,141<1D1L1T1\1d1h1l1p1t1p|1333333333333333333333333333444 44444 4$4(4,4044484<4@4P4T4X4\4`4d4h4l4p4t44550 *H 01 0 +0h +7Z0X03 +70% <<<Obsolete>>>0!0 +,)Xܞt~X0N0 0  *H 01 0 UZA10U Western Cape10U Cape Town10U Thawte Consulting cc1(0&U Certification Services Division1!0UThawte Premium Server CA1(0& *H  premium-server@thawte.com0 030806000000Z 130805235959Z0U1 0 UZA1%0#U Thawte Consulting (Pty) Ltd.10UThawte Code Signing CA00  *H 0Ƹ'` ie~m,pw&W?0!h.K5 Jڈ ! G yLnTiL:A}d{cE``1n&$ԴP`Y00U00@U9070531/http://crl.thawte.com/ThawtePremiumServerCA.crl0U%0++0U0)U"0 010UPrivateLabel2-1440  *H v-4Es4܎k.\L}hי.ȵ͊I:[ mRve"gSS7F/{El@!]uvf0߂/ ۟r7MwHJ? U,$00-GߍRFCmH 10  *H 01 0 UZA10U Western Cape10U Durbanville10 U Thawte10U Thawte Certification10UThawte Timestamping CA0 031204000000Z 131203235959Z0S1 0 UUS10U VeriSign, Inc.1+0)U"VeriSign Time Stamping Services CA0"0  *H 0 ʲ }uNgadڻ30X~k6xw~o< hlʽR-H=]_/kLR`@~ ?Ǵ߇_zj1.G 1s W-x43h/Š*Ë!fXWou<&]'x1"ijGC_^|}bM "Vͮv M٠h;004+(0&0$+0http://ocsp.verisign.com0U00AU:0806420http://crl.verisign.com/ThawteTimestampingCA.crl0U% 0 +0U0$U0010U TSA2048-1-530  *H JkXD1y+LͰXn)^ʓR G'/8ɓN"b?7!Op18UN$ҩ'NzaA*^ݻ+>W~ +;R8'?J001i9u<p-~0  *H 0U1 0 UZA1%0#U Thawte Consulting (Pty) Ltd.10UThawte Code Signing CA0 060210000000Z 080220235959Z01 0 UUS10UIllinois10U Schaumburg1 0U Macrovision Corporation10U  ENGINEERING1 0UMacrovision Corporation0"0  *H 0 ϥú*)$ų$g 'dM*(Qa3wV#q.}6 ZߕN*yu%V{(U705031/-http://crl.thawte.com/ThawteCodeSigningCA.crl0U%0+ +70U000  +702+&0$0"+0http://ocsp.thawte.com0 `HB0  *H d0S?>S"W`'qs 7I5R.M5mJ>ox[^40 @¥47ͣ,rh~ԩZҦښ=;u|*D00 +)2 ^v0  *H 0S1 0 UUS10U VeriSign, Inc.1+0)U"VeriSign Time Stamping Services CA0 031204000000Z 081203235959Z0W1 0 UUS10U VeriSign, Inc.1/0-U&VeriSign Time Stamping Services Signer0"0  *H 0 P(HhzDfu]~ĸc&=C|8%Usu'iN \ *UV!a3kݣ7e S\|f5_EvNS \0"7LB U?R,z򢪍5]j=k㿖`@DQn*(P{J 0kX@( ~|vqiOG05!b<+َ*{\{❥o<1$0 0i0U1 0 UZA1%0#U Thawte Consulting (Pty) Ltd.10UThawte Code Signing CAi9u<p-~0 +0 *H  1  +70 +7 10  +70# *H  1IM[bFìLhQ0. +7 1 0http://www.macrovision.com0  *H !j6 'mB,xPh0Q}6EwU`)j.vDLeĴ|kH*5'yWe[z>SˊHn^.t6Jl8ndT7lDq*kR]^3 @"S)LQ)8b"3ݬ#:m1*Uoc0}-%oW 9%r/%%)z9e#X 7,%^@@TޅUD|]wxb 'TVxeXǤc DhTcJPmUX|`8^>C w@HA7CrDBE%@HD3?(AA+HA,@HDAED1H:- @HArD.ArD:[>>X;;< >GF(H C1A5G=F C1A5G8% C1A5G=F C1A5GA8, C1A5G=F C1A5G8"$3UjhP@h@dPd%XSVWe P@3Ҋԉ@ȁ @ʉ ܄@؄@3V YujYuP@؉@@HuЍEPP@EEtEj XPuVVP@P"EPE MPQYYYËeu=Ȅ@u t$ h0`@YYÃ=Ȅ@u{ t$ YhP@áԉ@th`@h`@h`@h`@jjt$  jjt$  Wj_9=@ut$P@PP@|$ S\$=@ @u<Љ@t" ̉@Vq;rtЃ;5Љ@s^h`@h`@*YYh `@h`@YY[ut$=@P@_Vt$;t$ s tЃ^USu5Y Xu `jX  @MM @H `@`@V;}4I+э4@`@& Ju5`@=u `@p=u `@]=u `@J=u `@7=u `@$=u `@=u `@5`@jY5`@Y^`QYE@ u P@[]ËT$ `@98`@V8`@t4I48`@ ;s9u I^ 8`@;s9t3Ã=ȉ@ucV5؉@<"u%FF<"ttP; YtF>"u F < vF> wt< v^S39ȉ@VWu5@3:t<=tGV(YtPTY;5@uj Y=@8t9UWYE?=t"U;Yuj WYW6YY8u]5@Y@_^ĉ@[UQQS39ȉ@VWuI@hVS P@؉@5@8tEPEPSSWMEMP;ujYEPEPEPVWEH5@_^@[UMESV!uW} Et7} 8"uDP@"t)t%@t tF@tՊFt&F8"uF@CtF@MZ@ !L!This program cannot be run in DOS mode. $t''''''脯'q'''Մ'''''5''Rich'PELjD @P@4T(gP.text5@ `.rdataPP@@.data)`0`@.rsrcgp@@@t tF@ t t ūuHtfe8 t u@8t7} UE3ۀ8\u@C8"u,u%39}t x"Pu}} 39U‰UKtCt\FKutJ}u t? t:}t.t@tF@F@t@@Xt&Ft'E_^[]QQ @SU-4P@VW333;u3Ջ;t  @(0P@; @;u Ջ;f9t@@f9u@@f9u+Ƌ=,P@SS@SSPVSSD$4׋;t2U ;YD$t#SSUPt$$VSSׅut$k Y\$\$V(P@SuL;u 0P@;t<8t @8u@8u+@U Y;u3 UWV W$P@3_^][YYÃDSUVWhJ YujY5@@ ;sfF @D$PP@f|$BD$D0h;.|95@}RĈ@h Yt8@ ;s`@ 95@|5@3~Ft6Mt.u P@P@tNj@ȋ MHGE;|3ۡ@<4uMFujX HPuN@u NNC|5@8P@_^][DVt$j&P@f8MZuHj,P7Y;Yt0@8t9;uA8uj SP tttEP}Y[3j9D$hPPP@@t6@u haY uu5@LP@3jXUSVWUjjh@u)]_^[]ËL$AtD$T$SVWD$Pjh@d5d%D$ Xp t.;t$$t(4v L$H |uhD@Td _^[3d y@uQ R 9QuSQ`@ SQ`@MKCk Y[VC20XC00USVWU] E@EEEECs {ta v|tEVUkT]^] t3x<{SkVS vjDaC T{ v4롸UkjS]]_^[]UL$)APAPy]Ȅ@t u*=4`@u!h$@YthYUU3ɸ`@;t A=pa@|V;`@Ȅ@u =4`@\hPj P@u\hS@P[YY\WP\@Yt }w u,9Ev'Ē@"tMMȉMtEEtE؉EE E t83_^[̍B[Í$d$3D$ST$t B8tфtQu WV ؋ ~333ƃu%t%uu^_[3ËB8t6t8t't8tt8tt^_B[ÍB^_[ÍB^_[ÍB^_[̋L$WSV|$tiqtOL$F8tt F8t u^[_3ÊF8u~at(8uĊAtf8t3^[_G^[_Ë^[_UWVSM&ً}3ˋu F3:GwtIIы[^_Q=L$r-=s+ȋą@Ph@j5@pP@@uËL$%x@%|@jt@ @l@Xá|@ @ ;sT$+P r3UMSVu AW+y iDMIM11UVUU] u~J?vj?ZK;KuL sL!\D u(M!!JL! uM!YM] MS[MZU MZRSJ?vj?Z]]+u]j?u K^;vMщMJ;v;tcM q;qu@ s!tDLu&M!1K!LuM!qM qINM qINu ]}u;M\ щ^NqNqN;Nu`L MLs%}uM DD )}uJM YJꍄ ED0Ex@ p@5TP@H h@SQ֋ p@x@ Px@ p@@x@@HCx@HyCu `x@xuiSjp ֡x@pj5@XP@|@@ȡx@+ȍLQHQPE |@;x@vm@t@E=p@x@_^[U|@@SVWu;x@uM; p@u%x@MB_^[á|@ l@VW3;u0DPP5@W5@xP@;tal@@|@ @hAj5@4pP@;ljFt*jh hWtP@;ljF uvW5@XP@3N>~|@F_^UQMSVWqA3ۅ|Cj?iZ0DE@@Jujy hhWtP@up;wtƍ4;sCu0jX^;uCF;sN;Euq )u 9U }ƍ4;urq;s~;Esvu@j^X;u%C@;]s +q aq16;s)E 9U r4맍;]s +‰A aAFk+3_^[S390@VWuBhS@P@;tg5|P@hS@Wօ0@tPhS@WhS@W4@֣8@4@tЋ؅t8@tSЋt$t$t$S0@_^[3̋L$ WtzVSًt$|$uuo!FGIt%t)uuQt FGt/KuD$[^_tGIuulGKu[^D$_ÉIt~Ѓ3‹tބt,tt uƉ3҉3It 3IuuD$[^_UjhT@h@dPd%SVWe39=\@uFWWj[Sh T@VWP@t\@"WWShT@VWP@"\@9}~uuYYE\@uuuuuu uP@9} uT@E WWuuE$@Pu P@؉];}$eĉE܃MjXËe3}܃M]9}tfSuuuju P@tMWWSuu uP@u;t2E t@9};uuuSuu uP@3eȋMd _^[E6$e܉]MjXËe33ۃMu;tVSuuu uP@t9}WWuWWuuVSh u ,P@;qlT$D$VJt 8t@Iu8^u+D$ËUjh(T@h@dPd%SVWe`@3;u>EPj^Vh T@VP@tEPVhT@VSP@jX`@u$E;uD@uuu uPP@9]uT@ESSuu E @PuP@E;tc]<ǃ$euWSV jXËe33M;t)uVuu juP@;tuPVuP@3e̋Md _^[áh@tt$ЅYtjX3UQ=D@SuEaz ]}(=@~ jSYY @Xuk@DJte E] j e ]jXMjjjQPEPh5D@ tuE EM [UQEHw @ARV5@DV^teMEj eEjXM jjjQPEPjmuE #E UWVu M};v;xur)$hC@Ǻr $B@$xC@$B@B@B@B@#ъFGFGr$hC@I#ъFGr$hC@#ъFGr$hC@I_C@LC@DC@ULU`UtUUUUUUV"V4VDVRVlV|VVVVVVVVVVVWW(W8WNW^WnWW@@__GLOBAL_HEAP_SELECTED__MSVCRT_HEAP_SELECTruntime error TLOSS error SING error DOMAIN error R6028 - unable to initialize heap R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data abnormal program termination R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point not loaded Microsoft Visual C++ Runtime Library Runtime Error! Program: ...GetLastActivePopupGetActiveWindowMessageBoxAuser32.dll.>@2>@>@>@f@@j@@\TWPT UU0U>ULU`UtUUUUUUV"V4VDVRVlV|VVVVVVVVVVVWW(W8WNW^WnWWgGetModuleHandleAGetStartupInfoAGetCommandLineAGetVersionExitProcess1TerminateProcess/GetCurrentProcessBUnhandledExceptionFiltereGetModuleFileNameAFreeEnvironmentStringsAFreeEnvironmentStringsWiWideCharToMultiByte?GetEnvironmentStringsAGetEnvironmentStringsWSetHandleCountGetStdHandlePGetFileTypeBGetEnvironmentVariableAGetVersionExAHeapDestroyHeapCreateXVirtualFreeHeapFreeRtlUnwindvWriteFileGetCPInfoGetACP|GetOEMCPHeapAllocUVirtualAllocHeapReAllocGetProcAddress.LoadLibraryAQMultiByteToWideChar LCMapStringA!LCMapStringWGetStringTypeAGetStringTypeWKERNEL32.dllF#@@   @S@S@ R@ R@R@hR@DR@R@Q@Q@Q@HQ@ Q@xQ@yQ@zP@P@P@`y!@~ڣ @ڣ AϢ[@~QQ^ _j21~pb@pb@b@b@pb@@@ ((((( H .( (@X p(8H XhhИ(0h%@hP(0`xpww??( @xpwpp??( (0`B6*~jVvºnZN~ZJ:zf¾NB2rf^~nbfRBzʾvfRzbƈF:2vZNB¶rbvbNƾ~nRB:n^ꈾJ:.rbRখznvfjZJƺvfZN>2~B:.~ƺbN>bNBr~n^n^VZN>ƾzrjfVJºzjVF>2vnVJ:B6.~nZvr^N~RF6pzj^vfVzjʈvbƾƏ~rvjˆzn^NZJ>zjꈺNB6∪zvj^rbfVF~r¶^RB¶vbRRF:r^ʀƾbRBJ>6rvfj^RF6*~jZ^J:ʾzfRzfJ:2^NBƶºzbN~nrbVznvfnZJƺvjZN>6~F:.ƺ^N>ƾjVJºJ>2vVJ>F6.nZzzfV~jvbֈƾvjˆzºzjRB6vjbrfjVF²VF:r^bRF҈rd***:d***||||*|LQ6666Q|d|66aa11111a66|*рZ611a6Q|ї|6{1,,֪1a6|*ї|Q1,$o o$16L*U|6{1_o )YYYY)) oa6*|6a,o jYGY)j o,a6L*U|6a{WY) oa6|ZQ{833Ba22222222ʡGYj a6|*1F ^BI!!2Y {*|61ڙBh1 X!2Yj,16|0{_oB1  2Y oaQр|61 ̋C##O X2) 6|d*LoB A#X2WoaQ:61, Ÿ3q/{6R#) 16U|6$ 16Bi/ 7R# 2Wjo|:|o2}F1\-Ý7@. G ,a0d*a, `mhRq!2) 16:Qa )2!8ĥ%BB̬2Y $16U61 Y2#BSm}< WY $661 Y2.1-Š Wj$661 Y2Oo/Š Wj$_6ї61 Y2O@%/Š W $6Q1 )2!7-<2Y $16a, )X #'mM#5!2Y 16::=*|oG@7g̷9BBBX) ,aQ0]|6$ Y2! #^襥̇;h+!2WYoLZQ1_$ G#1%h# 2,16|Q}2X#xt5fW)aQ:=|Fu`ǡ!! 6Bgf2)LȟL5;2cO#3"mT3X!2A}160Z8" #ɜ祥s XfIL0= #R74sc+1Q=vHO#@R7"[EC}Q||VCO#RR7777lHV HlOl1:]*O眮R7(((((qC>k띴= qRR ((r焄zzR ؝=rNDrTTTTTTTTTrDDk4QZ=kTTJJJ%%%%%%%JJJTTQ|=0 >ppppppppppppppQZ*0 ⍍*y~~~~-sߧȩP&>> >>4K::ȩ?˄ 00??( @>2&BzfR~Ҏvº^J:n~zfZNB6¾jZJ~nbNުrF:2枎~~ʾfbRFvzfvFB:.r^VJ>Zr^N֮Ƣ~jZ֊¾ފrbv>6.֒~RVF2ξbR>znJr¦vfºfRFnjβvjZƺNj^VBvfRF6*΢zb^NBƾΪbN>2¶~~¶n>6*Zv^N:ʦzRF:fƾnZJzrfFF>2~nvVJ:.ZN>rbVBʪ~nZ~ºVF:r~rfVFR~jVzҚzvҊzjRB:rbޚʾҺbVF~jʮrbRn¾ZvbF6.~N~r暆rfZNޒ^RJvzj^ZF6fvjnZƾnbV沢ʪ^N>^¢n^NJ>6vzZJ:RfVJB2&ꦢzfVbvڎzfJRB6zjF:.r^ZJ>jƾFB6.~֦^bRBʊznzƒº֖rJⲦ^ƺvfV޲z¶B6*rƾJ>2J>.ZNBn~n^vNºFƂrfξ^޾jvbRJʞvbVvjFn^¶bN>zjVJzRvjVbG QQQQ GG mm\CC\aG[ a\d d\a[ Q\ zggz \  #&}}&# Q S>#vY66Yv# Q S #6ZZ6} [QS Y;;;;kZvӋ [ \ / źJJEkYӋ G # o1n J;v}# G \ &/RM:K'nx; Q #5*{T/KHKkZ6# Gdz5,!^KnJEzdGG v;EĈ4d+K kv \ &YZ;J]5,3;ZY&  C g}6;JeF J;6}g C C g}6;Jn]SwŖ J;6}g C\ &YZ;nסqd';ZY& [V vk 5cno1kv [dzEJn:p MEzdG(Qz֟vZkn ˏx;#  ՞kkkkŭ0WEO> QIEJ 1'Ksy+IEB G( =@ 1'K4s)8+ 3d -8fK:H4RXy'y [=j4DD2 7%ͨbLi{` 22""""""R%jj%RCQ(t{AA.....A%Q*<ttttttttttUG?L UQ[?{$ $|*G???( >2&>~fNz~r^J:rš~f^΢~nbvbNN¶N>2jVFjƮ~rZvF:.~jZFn^JʚvަjbzbƶF6.VF6BrVFznF6*VbRBrvzfV~ƺB6*²jVz>~޲n~fVҾ>2*^N>brҺzfRºjZFfv^J>.nZzf¶ZJ>򶚂jjRvnFvbRNB2Ʋv^^nZҢZJ:rZFNʖ~n®v>nZJ^B2&~fR~rR^J>ʞjn҆ʺ®Fr^J:.r^JJvZnrږzb~ʺZF:V~nfRBzfzfZ~ֆjVznB2*RbN>rºnZFJ>2zfƺbzbRRB6n^rZJrҪFf^zZn^nJZfBzRFZBbvBJJZ~vbj7F/  SZXG8\00LSx%G#1 ,+??+C R>@^^T3????8 6@/g^['K??L ,#^^ iS?, 7Z0+iQ^pIP_ZNt?l^^^"_N 9Y)!'&^ b== ;8{JJ(^kJd8 sr*VB4^HE :`-he^^Dauq$U< Mn7%X j22@n%%%(0` F8,/M?2aRD7VH;VG;UF:PC7QD8QE9UF:SD8QC6K=1aD7+/D7*,N@3tXJ1tA4(,F8,7UE8SE9M@6K?5PC7UG;XI=ZK?[M@]OA^OA_PB_PB^OA]OA\M@ZK?YJ>TF;RE9PD8L>2C5)7A3'RC6|UF:K?4MA6RF:XI=[L?^OAaRDdTFfVGgWHhXIhXIhXIhXIhWHfVGeTFcSE_PB[M@YJ>SF:OC7K=1|@3'H:-HVH:M@6L@5SF:YJ>\M@aQDeTFhXIlZKn\Mp^Nr_Os`Ps`Ps`Ps`Ps`Pq_On\Ml[KhXIfUGbRE]OAYJ>SF:OC7B5)HO@3fTE9J>3NB6VH<[M@aQDfUGjYJn\Ms`PubRxeTzfU|hW~jX~jX~jX~jX|hWzfUxeTvcRs`Pp^NkZJgVHbRE]NAXI=PD8G:-fPB5uTF:I=3RE9YJ>^OAdTFiXIo]Ns`PxdS|hVkYm[o\q^r_s_s_r_q^p]n[kY}iWxeTtaQp^NkZJfUG_PBYK>QE9I;/uPB4uNB6I=3SF:YK>`QCgVHm[Ls`PxdS}iWmZp]s`vbxdxeyfzgzgyfyfxdvbt`q^m[~jXxeTtaQn\MhXIbRE[L?SF:F9-uOA3fTE9H=2SF:ZK?aRDhXIo]NtbQ{gVlYq^uaxd{h}j~kmooooml}j{hxevbr_m[}iWvcRp^NjYJcSE[M@TF:G:.fG:-HTE9G<1RE9YK>aRDhXIq_NxdSkYp]uaze|h~koqtuvvvvutrol|ixeuap]~jXxeTr_OjYJcSE[L?QE9B5)HA4'UF9H=2NB7YJ>`QChXIq_Nn\LgVEfTEhVEn]L}jY~kvwx{}~}{zvtpl{hvbr_kYxeTr_OjYJcSEZK?PC7@3'RC6|K?5L@5VH<^OAgVHo]NxdSeTDvhY{ozndSC\I9aO@q_Oq~{vsn|ixdr_kYxeTq_OhXI`QCYJ>I<0|F8,7SE9H<2SF:[M@dTFm[LtbQkYbPAcRB`O?~m^~yuo}jxdr_kYwdSo]NfVG]OATF:@3'7TD7G;1NB7YJ>aQDiXIs`P{gVq^`O?]K:tcS{uo|iwcp]~jXtaQlZKcSEZK?H;/D7*,RC7H<2SF:\M@fUGo]NxdSlYvb`N?[I8qaR{uo{huan[zfUr_OhWH^OATF;@3',N@3tI=2MA6XI=aQDjYJs`P}iWq^{f_N>]K:rc¶ztlyfs_~jXubRl[KcSEYK>F9-tUG:E:/QD8[L?eTFn\MxdSmZua~kbP@r^L<ȾĹøxq}jvbn[zfUq_OgWH]OANA6F8,/NA6I>3UG;^OAhXIs`P|hVp]xdndTD_N>fUExlļo^NjYJʿúɿƻĸ{umyfr_~jXtaQjYJaQDWI=@3'/L>1aH=2MA6XI=aRDlZKubRkYs`{hquetbSkZJaP@^K;ueU]K;yż¹ȾĹxq|iuamZxdSn\MdTFYK>D7,aRC6E:0OC7ZK?dTFn\MxeTm[vb}jqyxjbPAraRo[JaQ@ļɿź{s~kxdo\zfUq_OfVG\M@H;0VH:E:/QD8[M@fVGp^NzfUo\xd~kt{s_M=w]L<ƿºǽĸ÷}umyfq^}iWs`PhXI]OAN@5RC7E;1SF:]OAgWHr_O|hWq^xemu}wgY\J:źcP@aP@_M>^L<^L<^L<^L{mxp{ht`kYubRkZJaQDQC7J=2I=3UG;_PBhXIs`P~jXs_zgovʿq`RcQAŷ^K;vhxq|it`kYvcRlZKaRDVI=I=2I=3UG;_PBhXIs`P~jXs_zgovȽ^M=ub\J9vhxq|it`lYvcRlZKaRDVI=J>3I=3TG;^OAhXIs`P~jXr_yfovźcRBeSB]J:vhxq{ht`kYubRkZJaQDQD8QC7G<1SF:]OAhWHs`P|hWq^yfmu}øĺy_N?}]J:vhwo{hs`~jXtaQjYJ`QCQD8PB6F:0RE9\M@fVGq_OzfUp]xdlt{ȽĹcRBt`NȽ_M=ug}vnyfr_~jXs`PhXI^OAM@4PA5C8.PC8ZK?eTFn\MxeTn[vb}jrzŹŻzk\^L=ǷdRA^M=aO?aN>`O?s{tlxdp]{gVr_OgVH]NAI<0K=0aB7.MA6YJ>cSEl[KvcRkYt`{hov~Ǽ_N>zj_N>qc}wp}jvbm[xeTn\MeTFZL?C6+aD6*/F:0K?5UH<_PBgWHs`PlZs`xe~ks{¶Ǽp`QiWGo`_M=ö~u}js_p_tbQlZKbREYJ>@3'/J>3F;1SF:[M@gWIseykqvwvv}¶_M>ztgscU}oby}w~l{gVr_OhWH^OAM@4K=0tB8.NB7YJ>`PC{o~qw|k[K`O>|pyj\|n`sg~ovcQn\MdTFZL?E8,t@3',E9/J?4TG;[M?thz~¶Ǽ{oxlyks`PhXI_PBVG;@3',G:/D90OC7WHD7,|@3'C9.H<2PC7YK>øĹƻȾʿúĻżżƽżr`RbRD[M@MA5@3'B4(HA6-L?5QD8th]»úƼɿ¹ûżƽǾǿƾ¹sfbRC]NATG;@3'HE8,fB8/K?4OA5½Ž»ļŽǾǿǿľcQC\NAWH2fVIYK>UH3J<0eVIVH;RE9B5)fB5)HC8.H<2H:/rf\YJ1M@4D8,@3'7@3',A5*tC8-E9.E7,D7*[NC~vka\NBH9-I;0F9.C6*t@3',@3'/A5)aC7+D8-D8-C6,B6*C6*B6*D7+E8-D8-A5)a@3'/????%( @ @3'%G:-`N@4OA5SE:SF:TG;UH3L@5[M@jYJxeTs`bP@\J:wǻ|s{hq^xeTjYJZL?@3'%G9,`F;0RD9aRDp^N~jXydfTD|sebP?Ĺxmvb~jXp^NaRDH:.`O@3C8.WI=fUGtaQn[|ho_fTD^K;VD3ù`M=uƾɾ¶}szgn[taQfUGNA5L>2G<2YK>hXIxeTs_}jx~n_[H8xgfUFv}js_xeThXISE8OB6K?4[M@kZJzfUt`lxsbTgTD̿VD3YG6YF6ZG7\I9vhxlt`zfUkZJZL?J>3L@5]NAl[K|hWuamz^L3L@5]NAl[K|hWuamzɽscTnZH{iXHzmua|hWl[K\M@K?4K?4[M@kZJzfUt`lx÷]K;hWHxlt`zfUkZJZL?I<0H=2YK>hXIxeTs_}jvǽfTEyhqcm\Mv}js_xeThXISE8J<0E:/WI=fUGtaQn[zgs}Ź{n^L;\I9aO?iXHv|rzgn[taQfUGNA5G9,`>5,SF:aRCtbRo^xd~kw\K;ø^L=}m`v{g~kYp^NaRDF9-`@3'%A6-MA6ZK>wkt{~m_^L;ylyj\|maxweTjYJ[M@@3'%E9-E:/TF:th¶~rxq_NcSENA5@3'@>5,L@5l`TĹȽ¸~tegWH[M@A4(@D7+C8/NA5÷źǽ¹ļl[K`QBI<0@3'">5+G;1j^T "   !#$%'()*+4-./0123&56789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ĺȾûżǾǿƾ¼ŽsaPBTF:@3'"A4(C=3*G:/yüƿžĽüſ`PAWH3+D8,ĽcTFUG;B5)NA4(C=3)A5*aSFNA5A4)C@3'"@4*>3)dYOSE9F9.@3'"@3'@?4)<0%_SIÿ~N@4E8,@3(@@3'%A4)`<0&=1%<0%?2&@3'A4(@3'?3(A4(`@3'%??(  YH:FxaOfRCZH9ZH9fRCxaOs_F\I: yaPkVFhVpZ|dgt]xcO]K;TD8\I: \I: r[KhUmUBjVwwttwiycOTD6\I: QB4hUudUwjl[G|dnmnspuaMTC6YH9FkVFlo^Nq]KlmmmslcP@XH9FxaOhVop^PTB2|ePqqnnxxaOTC6fRCǓwb~fyfq^N`K;gQoVintp[YH9ZH9nrsngRxk~zbLqszaWE7ZH9lrqknS?.w_HrrybVE7fRCǓwbr}v}gRuxhZ|jiTXF8QB4hV|}ste|p[ISC5XH9F^L C1A5G=F C1A5G9#'Z C1A5G=F C1A5GA9f C1A5G=F C1A5G9&(r  ( @00& (0` ʦ """)))UUUMMMBBB999|PP3f3333f333ff3fffff3f3f̙f3333f3333333333f3333333f3f33ff3f3f3f3333f3333333f3̙33333f333ff3ffffff3f33f3ff3f3f3ffff3fffffffff3fffffff3f̙ffff3ff333f3ff33fff33f3ff̙3f3f3333f333ff3fffff̙̙3̙f̙̙̙3f̙3f3f3333f333ff3fffff3f3f̙3ffffffffff!___www|?8???????7=??`?`?``7=????7=????( @{wpxpxwppxxwpx ~pxxxw pzxpxzpxx ( @00& (0` ʦ """)))UUUMMMBBB999|PP3f3333f333ff3fffff3f3f̙f3333f3333333333f3333333f3f33ff3f3f3f3333f3333333f3̙33333f333ff3ffffff3f33f3ff3f3f3ffff3fffffffff3fffffff3f̙ffff3ff333f3ff33fff33f3ff̙3f3f3333f333ff3fffff̙̙3̙f̙̙̙3f̙3f3f3333f333ff3fffff3f3f̙3ffffffffff!___www|?8????????????`?`?``7=???????????( @ffh{fwphxpxwppxxwpx ~pxxxwpzxpxzpxxxwwwwwwwwwww'wwwwwx ( @   wwww www'wwwwwx ( @ C1A5G=F C1A5G9~ C1A5G=F C1A5G:! C1A5G=F C1A5GA:,V$ C1A5G=F C1A5GH*->wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxwwwwwwxwwwwxxwpwwxwwwwwwwwxwwwww'wwwwwxwwwwwwwwwwwxwwwwwwxwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww ( @  xwwwwywwywwwa???}(( BMV$6(8 $        !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~w]y`v]sYrXqWoToTsYzbqv\p}q{bqVmRx`s¿߉uZqǼ¸xrjx`qVnTluZxĹɿumzakOsZuZxĹþqgtZnSuZxĹùw~ftZv]uZxĹugsXzcuZxĹɾoza~hLuZxĹż~gqW|euZxĹımyat[uZxĹӾvza|eHuZxĹƺz|du\uZxĹgkOuZxĹltZuZxĹ˾mtZuZxĹʼmlPuZxĹƸmyauZxĹi~hu[xĹȽ}v\zu[xĹ;rWu[xĹĴw|du[rŻ~fw]lkx{ʿ˺w_zax_uZw]y`|bimtxø¯uyaɿ·żxtYtY{apuȼμx^ƱmQuZksĸ®~h鼱}d|blĸͻmި{bmz¬|dȿ}gKl{̸r˒gnt[Ƌw]vijdzsøx^~ȷƼ~iKiμĮp|qĸ~g؍z`İϽk{aʷʷyo÷ŶnǾjŰ}wо~i˜mӹ|ŵxx}|zyxxͺʵz~|{xvtrqnmj|d}fmRƼ|dǴz~phmR횊tλƯ{{~~®ıƳȵɸ˺˺ƵqmR·oѿ̹̹̹ͺϼо¶ĹƼɾǼumRpUúvmR~źvmRܐ~eʿĹvmR|ưĺwmRȾuô~ĹwmRn{ϽùvmR{ùvmRәrǺùvmRyzȳùvmRżzƶĹwmR擀iƺ~¶ĺwmR°{ĹwnRƑ~eʽĺvnSz`|̹źvnS~ŵ}ĺvoTw\ɽǼʿwpT}{ůźîŰǴɶʸͻξø÷˻tpUƻxǹ¸}xmqVi¶{ϼDZ~}|zwupusX|½qVsYv]t\t\t[u\v]w^x^w^x^x_z`h      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~МvĶ˸wv~ɴ«~fvôнxn瘇pѿűx_«Ĺwt[oSɿμ|c}ȴȶ}x_ٌx_ñssY̺ƻ~gv\͔j¬ĸz~e~gоĸwy`w`ɒhŰƻryaw^t{cmRl؄nRDzöjw]~hLnrɿyhx_sYt[nnSIJɿtl|cv\rXqWqVpUqWqXyc¹iƻ}wuush|eoUvy°ȾĹȾhnSВgʺȾrnTy_ĺĹtnTvpĹtnT~euƸĹtnTǽx_wĹtnTrXtƻĹtnT񫞋~frɾĹtnT||dpĹtnT䟏zy_lĹtnTy_mȽĹtnT騚uZmĹtnT򷫜|djzĹtnT·mQjsĹtoT֟yy_nĹtoT깮}chpĺĹuoUÿџyoSjrùĹupUǽnrWksȽĹvqVww\gpwøĹwrWή|cx_hqx}øԽrsXhv[|cjovyz{~p}dsYùluZrWv[v\{b}e~egy`}du[øŻnq  }((   C1A5G=F C1A5G8T C1A5G=F C1A5GH> C1A5G=F C1A5GH+0 C1A5G=F C1A5GHvBMT6(:S  AAD{z}mmoFEIMKNKKNWVY+*.~}~}USV::=fehTSV437ddg;:=``c76:ooq{{~215@?B""%kkm+)-jil97;~98;\[^hgj('+SSUpps97<~hhj[Z]325UTW447uuw~~758/.3`_b\[^&%)WVYkjm437hhjUTW.,0VTWIHK~}447659xxz104~}"onq"!&wux>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmor=st>~wxyz{|}pJ:N=B1th _Q?.( gZ[N)")" *늁wJ;(!P@w ?.t  '- 핍3!(&3"'..'=+/%$UGnc ..! uiK<".%+'½(--+((.%-"m`SE%%[Lh[ *.%-&7& ! 4"'*.%-- 펅6%?..*.%-/! K?EC?6BEAC Sw~p`x~`zp`x``wpwxp`xwpw`xwp`wpxwpwpwwwwwppD@@NOxwwNwwwONpGvdG~wdGwtDDDDDD@???????? ( @wwxxwwxwvlxw~ggflx~vffwtw~ggwwx@~w|x@w~fwx@~fwwx@w~wx@~gwwwx@wvwDDGx@|Gx@wwwGx@ww|lGx@w~nfGx@flGx@wwfwGx@wwwwwwwwwwGx@wwwwwwx@EȈwwwwwx@Dwxwx@Dwzwxx@@www@zwww@xwpwwx@wpw@ww w     rogram cannot be run in DOS mode. $GGMMMMAAAFFFFFFFFRR zz1111MMM^zz1111MM^^zz1111M^^zz1111^^^zz111z^^^zz11zz^^^zz1zzz^^zz00& (0` ʦ """)))UUUMMMBBB999|PP3f3333f333ff3fffff3f3f̙f3333f3333333333f3333333f3f33ff3f3f3f3333f3333333f3̙33333f333ff3ffffff3f33f3ff3f3f3ffff3fffffffff3fffffff3f̙ffff3ff333f3ff33fff33f3ff̙3f3f3333f333ff3fffff̙̙3̙f̙̙̙3f̙3f3f3333f333ff3fffff3f3f̙3ffffffffff!___www|?8????????????`?`?``7=???????????( @ffh{fwphxpxwppxxwpx ~pxxxwpzxpxzpxxp ??`?`???(0`  """)))UUUMMMBBB999|PP3f333f3333f3ffffff3f̙3ff333f333333333f33333333f33f3ff3f3f3f3333f33̙33́u333f333333f3333f3ffffff3f33ff3f3f3f3fff3ffffffffff3ffff̙fff3fffff3fff333f3f3ff3ff33f̙̙3̙ff̙̙̙3f̙3f333f3333f3ffffff3f̙3f3f3f333f3333f3ffffff3f̙3f3ffffffffff!___www yxR1ᘘWRXyxRRyyx xRyy\xRXyRRRyRXsy풒xŸxRŸyRxŸWRRWXRRWxxXXRRxXXRRxxRRRxRxx ố (fh   0000h.!( pwx x{߈}wpwwwwxpwxr""/pr""/pwr""/pr"/prpp( @ """)))UUUMMMBBB999|PP3f333f3333f3ffffff3f̙3ff333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f333333f3333f3ffffff3f33ff3f3f3f3fff3ffffffffff3ffff̙fff3fffff3fff333f3f3ff3ff33f̙̙3̙ff̙̙̙3f̙3f333f3333f3ffffff3f̙3f3f3f333f3333f3ffffff3f̙3f3ffffffffff!___wwwozR1MLozR1MozR1ozzRoLLLLL( @wxݐxݙpٙxx٘xwوxxxxp xwxxxxpxx{xxpxwݏx{݈p}݈wwpwwpwwpwwwwwwwxpwwpwwwwpww"""""/wwp3:/33/wwp򿸃3:/33/򿿸3/3/򈿿//"""""/wwwwwwwwp ??`?`???( @ """)))UUUMMMBBB999|PP3f333f3333f3ffffff3f̙3ff333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f333333f3333f3ffffff3f33ff3f3f3f3fff3ffffffffff3ffff̙fff3fffff3fff333f3f3ff3ff33f̙̙3̙ff̙̙̙3f̙3f333f3333f3ffffff3f̙3f3f3f333f3333f3ffffff3f̙3f3ffffffffff!___wwwCCC껻X1CCX10CX10C10C0CC꼼C꒒CXXCXXRssCXXRsxCXRRsẺCRsxẺCxẺCCzz^zzz111111MMMMMzz^zzz111111MMMM^zz^zzz111111MMM^zz^zzz111111MM^^zz^zzz111111M^^^zz^zzz111111^^^^zz^zzz11111z^^^^zz^zzz1111zz^^^^zz^zzz111zzz^^^^zz^zzz11zzzz^^^^zz^zzz1zzzzz^^^^zz^zzzzzzzzz^^^^zz^zz888(0`ߐXؘxXؘs0wU٘3pwxxUه3www]ه8wpwwxu]swpww]3wwx]wwwpwwwwwwxwpwwww{wwpw=xwpwp3ݕxp7ݕwxw3}ٕx 7}Uwpxp37ݙUXwpwݙUXppxp ٕUXp UXpwwwpppwwwwwwwwwwwwxpwwwwwwxpwwwwwwwp"""""""""www򪪪wwwp򪪪""www򪪪wwwp򪪪www򪪪򪪪www򪪪򪪪򪪪򪪪򪪪򪪪"""""""""wwwwwwwwwwwp888UjhdPd%0ESVWePEEu ttPtPM_^3d []ÐVFtPp6tVd^ÐD$VWPFOtP; >h0 FPF Ɔ(_^UjhdPd% SVW3ۉeu쉞]P:u!hV2Md _^[]Ë:tNAQΉF Ru:u(PhVO 2Md _^[]ËM_^d []ËMh@QÐUjh(dPd% SVW3ۉeu]0}FPhWF MQWPE]؅tWhV uwhgUjRtWhpVc PF^tPNESPJtWh V. MQ u0hVEtP2Md _^[]EtPM_^d []Uh\RÐtPÐUjh@dPd%SVWEeVPQhRuEEnP~=u9Qh@V' RVMd _^[]hVhVMd _^[]ËEhlPgËM_^2d []ÐUjhPdPd% 0 SVWeMEGwVQj P}Ev=t?hW@2Md _^[]ËuhVF@BËM_^d []ÐUjh`dPd%SVWeuN F~EWQj P؅t@URhV uHPhV 2Md _^[]FPaF u@MQhVK 2Md _^[]Uh`R%ҋM_^d []Ujh{dPd%SVWeh}OEEt 3G hPΉuEu=QCRhdWq 2Md _^[]Ë}hWBMd _^[]ËEhPMCÐUjhdPd%TM SVWEePQREu (t!PsMd _^[]ÍQVMRPhQNERPQw@Md _^[]øËM_^2d []ÐPVW|$dž $D$ (L$ ,D$L$ 3T$T$fD$TRVL$PQRD$D$vK@PD$hP L$T$TD$ QNRPQzdL$w_^PÐV t(Wh0 V =th0V׋D$ PV_^VƆƆ$^VtP h0 V^ÐUjhdPd%E SVWuePQEtPUR<tAtPSt(Md _^[]Mh4 ËM_^2d []UjhdPd%DSVW3}eE3ۍ~Pu]E<}]ĉ]]EdE@u&hLT2Md _^[]ËE;t`h'P=uh5u!h\"Mh@8tWMQM_^d []ÐUjhdPd% SVWeuEtFjhjj~jhWu6Wh|P Q2Md _^[]ËM_^d []ËMhl.MZ@ !L!This program cannot be run in DOS mode. $@ZF!4F!4F!4=:^!4)>>!4)>?J!4-O!4F!5/!4@?A!4'2G!40G!4RichF!4PELjD! 4`d0@@l p.text+ `.rdatas @@.dataPP@@.rsrc0@@.reloc@ @BÐUjhЧdPd%SVWePhuE$uh.2Md _^[]ÍNQjhR u$PhQ R릋4M_^d []ËMhQbÐAQPhPÐUjhdPd%USVWeEjP3IuQRQE(u6h$#2Md _^[]Mhm֋M_^d []UjhdPd% SVWeuFEt#PhTP QM_^d []ËMh< ÐD$VPL$hQc T$R4^Vh0  PƆ^ÐVt2 t(Wh0 V =th0V׋D$ PV_^ uD$h0 P2L$PQQV0jL$jQjPjh,thMT$RA^YÐL$$T$VPQR jD$PjV$VhQRtVi^Ðjh!dPd% S3VW\$$< DŽ$4 V*h`V|$|$054 94 hLP);KD$;tPL$UQh0W\$ ST$RL$D$PQƄ$@ \$=?3$1$0f?3$1$0f?3$1$0f?3$1$0L$T$$f$0RPjQl$4l$,l$0l$8,T$ $0L$RPjQT$($0L$RPjQT$$0L$RPjQjT$R$0V$4P$8Q$<RP$Dh Q$4 $LRP?3|$U\$TL$T$TfQV$\R$`P$dQRHu[Ãr 3˿~3σtJ2t#2t2t 2t_B[ÍB_[ÍB_[ÍB_[U =,SVWuu u&YYlju YMFEAEfAEAMtW9u3kjE5jPjuS5D '$ uf}f}fEEEAu f@fFEAu tS>u3ajE5jPjuS5D # ufuuCfufEE EA$<uf@f;uft-u Mj1Yj"f;YH jY3_^[U EEIPEEZEEPEu P&U SVu WjE Y3}j_ʋ#DFuUuE Pj[#L5ttBڊtj#XL5uB"BE _^P+#[ËD$dj 8Yt< 3Ɋ %-    Cu 83r`H 5< 0s32/8 >3;u,9 8 ~ 8 9 u/.2.8 uQYjX US]Vu W}u =8 &tu"L t WVSЅt WVSu3NWVS8E u u7WPStu&WVSu!E } tL tWVSЉE E _^[] D t u=H uc8t$8h`YYUjhphPdPd%SVWuu;j YeV9YEt VP9YYM}Qj YÃuSj YEEPEPVF E܅tPuu'G M }uu j YVj5hMd _^[̋L$tAt@u~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+jPdPD$ d%l$ l$ PUWVu M};v;xur)$88Ǻr $P7$H8$7`777#ъFGFGr$88I#ъFGr$88#ъFGr$88I/888 88777DDDDDDDDDDDDDD$88H8P8\8p8E^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $9$9IǺr +$8$98909F#шGNOr$9IF#шGFGr$9F#шGFGFGZ$9I99999999DDDDDDDDD D DDDD$9999 :E^_ÐFGE^_ÍIFGFGE^_ÐFGFGFGE^_V*5MY +;s=RLP5I u3, +  D$ *^t$yYHh Yu jXY  UVuW 9>t? E@ft~to}uijVuu V~ tP8csmu,9xv'HItU$Ru uVuuu Pу u uu$Vuuu P jX_^]UE e@E|M;A| SVucsmW 9K~ub9~u]~uWxl&pl@pjVEE*LYYu3 9~u9~u ~u 9~9~}EPEPWu u؋E;E9;|;{wCEC E~dF@ xE~v7u= uM9EME}$uu$u S7uuuuu V ,}Ei}t jVqYY_^[À}u u$u uuuuu V UQQVWxht!u$u uuuu uus}EPEPWu uE;EsO;>|C;~>F NHtyu&ju$u VjPuuuu u ,E_^VW|$ GtJxPtAt$N;tQREYYu"ttD$tt t u3jX_^UjhhPdPd% SVWe]su};utU~;w|eGDt hSPfMu/YËeM}]uG4u릉sMd _^[ËD$8csmt3U} S]VW} tu SWu},uuWu,u$6uuWFhu(@Gs uuWu,tWPk_^[]UjhhPdPd%SVWe]]ԃeu FE+@lE @pE}xl MHpeEu uSuVEԃeM:EԋMd _^[unYËeejEPYY3ϋu }E؉FMHlMHp?csmu)u# u}u}tPWYYËD$8csmuxux u xujX3UjhбhPdPd% SVWeMAuxkA`U | etDujvGYY0jWGYYFMQPYYutR]jsFYYjWFYYvsW ~V뗃~]jsu:nFYYjWxFYYt~vVsYYPWy f4FYYtVjWBFYYtHvPFYt;tjFPsYYPvWFPsYYPvWMMd _^[jXËegUjhhPdPd%QQSVWeEtHIteQpNMMd _^[38E ËeL$Vt$Qƅ| 42I ^USQE EEUuMm^VW_^]MUuQ<]Y[ V tt:jtj EYYt)V5ptV4YlNjX^3^o tPx ËD$@PP@VW05u?jtjDYYt&V5ptVYlNjYW|_^áVt$u PtlF$tPYF(tPYF0tPYF8tPYF@tPYFDtPYFP=PtPYVYj5p^UjhhPdPd%QQSVWe3u9p`tEP`u jXËeeMyDUjhhPdPd%QQSVWeetEjXËeeMI5 t$YYÃ|$w"t$Yu9D$tt$DYu3Ujh hPdPd% SVWuCu;5j p YeV,YEM Etmj YÃuZEtpj^u;5Lw.j  YEP6YEM Eu-Vuj G YËEujX$Pj5Md _^[USVu F ^@tfN$F F fe $ f F u"tu SEYuVrEYfF WtgF>+HNIN~WPSYC E 6tˋ p@ t jjSFB FMjE_WPSC E 9} _tN E% F ^[]UHSVW} 3Gۉuu} M3Mu39U |xÊ38E$OMỦU؉UUUUxà t;t-tHHtYMPMGM>M5M,*u#EPYEM؉EEˍDAU*uEPYEMˍDAЉEIt.ht ltwMMM ?6u4uGGM} lUЋ pUDAtEPuP G} EPuPf %ÃgeXxCHHtpHHtl fE0uMuuEPfEYȉMu MENf8@@E M@;ʉ}EfE0uMfEEPt;0PPC E}2E)Zt2 tHYEEEPYt3Ht,EtMEEeMEPu guEEũEuHM@EPPEPXut}uPdYguuP\Y-u M}WjYiHHtQHHE'<+u MNt8t@+EEEEt]EE0QEEHEEt;M5EPE Yt fMfME#M@E Et EPYAE t!E@EPt Y%YE@EPtYY3E@t|s؃ڀMEu}} Ee ueEEEM t;ERPWVEUBuċ؃0uWVA9~]ԋEM뵍E+EEEEtM90uu M@M0E}]@t&tE-tE+ t E Eu+u+u uEPuVj EPEuuP2tuEPuVj0}tA}~;E]xfCPEPC?YY~2MQuPEPOuEPuuuEtEPuVj q} Gۉ} E_^[ÀIVHqHHHH1IIUM IxE QuYYEu]]VW|$O~!t$Vt$t$ >tO_^S\$ KVW~&|$t$WFt$Pu ?tK_^[ËD$@ËD$AQËD$f@V55555^VW=t+t#ttt P6 Y`|5555_^UEV<4u>WjYujzYj>YWu >Yj Y_6^]UE4]USVWjzuY;Y]u3pV3Ҹh9tt0B=X|EPSj^;!j@%D Y3@9u󫪉}MA;A@ej@Y3@4Rx;t,Qt%;wU`A@;vAA9uE}rE,Pl YD RAAyGƀA@=rSYD 5,%,3 = tjFY_^[ËD$% u %u %u4  ËD$-t"t t Ht3øøøøWj@Y3@3 ,D _UEVP53@;rEƅ t7SWU ;w+ȍA ˃BBBu_[j5D 5PVPj=<j5VPVPV5D j5VPVPh5D \3ftA@tA 〠@@AA;rI3ArZwAȀ @arzwA Ȁ @@;r^Ã=ujY̋L$ WtzVSًt$|$uuo!FGIt%t)uuQt FGt/KuD$[^_tGIuulGKu[^D$_ÉIt~Ѓ3‹tބt,tt uƉ3҉3It 3IuuD$[^_UjhhPdPd%SVWe39= uFWWj[ShVWt "WWShVW" 9}~uuYYE uuuuuu u9} u4 E WWuuE$@Pu ؉];}$:eĉE܃MjXËe3}܃M]9}tfSuuuju tMWWSuu uu;t2E t@9};uuuSuu u3eȋMd _^[E6$9e܉]MjXËe33ۃMu;tVSuuu ut9}WWuWWuuVSh u ;qlT$D$VJt 8t@Iu8^u+D$ËUWVSu } xu; t.F'G8t,A<ɀ A,A<ɀ A8tx = j j$3ې t'FG8tPS8؃88tX u  j[^_UeSVu 3W]] }}3ۃ=~jP:YY pA;t6MWEWP% YYP FFP]: tFFPK:Y>%eeeeee3e]]]E]^F=~jP :YY pÊAtEEDCЉEeN>t^*t2FtTIt Lu7EE~6u,~4Fu#EЃee'E"htlt wtEEEMM}O}u uEEE@EԀe}uM}u>%uME xnuDV0uMuMWSYYMWP}MWSs}uE̅u 8EuE_^[Ã=V~t$jV0YYt$ppu߃^ËT$Jx A Rk1YÃ|$tt$t$12YYVt$Wt$W20YYu_^áth h hhjjt$  jjj Wj_9= ut$P|$ S\$=  u<t" Vq;rtЃ;5s^h,h$CYYh8h02YY[t_t$= _j Yj YVt$;t$ s tЃ^UHSVWhYuj(Y5 ;sffF $ލEP̰f}E8X;E;|9=}Vh Yt< ;s``@ $9=|=3~LEt8t2u QȰt#΋ M  HEFC;|3ۋ ۃ<4uMFujX HPİtWȰt %>uN@u NNC|5_^[SVWt7;s!_ {tS$$;r6&Y|_^[S39VWu5< 3:t<=tGV6YtPaY;5 uj Y=< 8t9UWYE?=t"U,;Yuj YW6YY8u]5< Y< _^[UQQS39VWu hVSаH 5 8tEPEPSSWMEMP;ujYEPEPEPVWEH5 _^ [UMESV!uW} Et7} 8"uDP@"t)t%At tF@tՊFt&F8"uF@CtF@At tF@ t t ūuHtfe8 t u@8t7} UE3ۀ8\u@C8"u,u%39}t x"Pu}} 39U‰UKtCt\FKutJ}u t? t:}t.tAtF@FAt@@Xt&Ft'E_^[]QQ SU-VW333;u3Ջ;t  (ܰ; ;u Ջ;f9t@@f9u@@f9u+Ƌ=SS@SSPVSSD$4׋;t2U;YD$t#SSUPt$$VSSׅut$Y\$\$VذSuL;u ܰ;t<8t @8u@8u+@UY;u3 UWV W԰3_^][YYVt$j&f8MZuHj,P ,Y;Yt0@8t9;uA8uj SP) tttEP}Y[3j9D$hPt6u h^Y u u53jXáVWufS39U-h~@=p h@h6hj6vj5ՃC;|5j5]['u"(FthjP6;u5_^jX D t u*=H u!h YthYUU3ɸ;t A=(|V;D u =H \hPjаu\hصPYY\WP\@Yu;uM; u%MB_^[á VW3;u0DPP5W5;ta hAj54;ljFt*jh hW;ljF uvW5h3N>~F_^UQMSVWqA3ۅ|Cj?iZ0DE@@Jujy hhWup;wtƍ4;sCu0jX^;uCF;sN;Euq )u 9U }ƍ4;urq;s~;Esvu@j^X;u%C@;]s +q aq16;s)E 9U r4맍;]s +‰A aAFk+3_^[UQUS] V W}e+G ;M|vE+ȈG`seE4;rU;s 8u@;uBE;w+;v';s338u@<tC cC+MEE_^[VC20XC00USVWU] E@EEEECs {ta v|tEVUkT]^] t3x<{SkVS: vjD轪C T{ v4롸UkjS]]_^[]UL$)APAPթ]W|$j$L$WtAt;u~Ѓ3ƒtAt#ttt͍y yyyL$ tAtdGu~Ѓ3‹tt4t'ttljD$_fD$G_fD$_ÈD$_ËT$L$u<:u. t&:au% t:Au t:au uҋ3Ð@ËtB:uA ttf:u t:au tVt$8csmuxux u tPYt V 3^h 5 UjhhPdPd%(SVW]3;uu SYu ;u S Y9}܃j Y}SYE;;5wLVSP t]8V!YE;t*CHE;rPSu#SESP9}uK;uj^u u VW5E;t#CHE;rPSu̱SuyMZ9}u";uj^u VSW5E܋E;9= VLYu ]3j GYÃGw;vj^u }܃j YEEPEPS }Ѕ;5Ls\SWuutEE8SNYE܅t*E;rPuu詰Wuu]}uSVj5E܅t=E;rPSubWuuVSj5E܃M&E;uf9= t^VYKu ]j Y33w;uj^VSW5;u9= t VYu3Md _^[UjhhPdPd%SVWuFj YeuVYEt v uuM }Uuj 9YÃuFj YEEPEPu E؅t 0uuM-}uuj5 ƋMd _^[Ëuj YVj^t$ t$ t3^Vj^t$ t$ t3^Vj^t$t3^Ujh hPdPd%SVWuu u uw3;uj^u 3ۉ]uA};=w|j Y]WYEM9]t^uH3ۋu j YÃuA;5Lw9j UYEP4YEML9]tVSu6 9]u>Vj5E9]u'9 tVBY03ۋu j CYËEMd _^[j 'jYYj% tt$ЅYtjX3Vt$;5s@΋ Dt%WVct$t$V(V_^m k ^Vt$WVYu C -t$jt$PXu03t PY΃Ƌ dD_^Vt$;5s@΋ Dt%WVt$t$V(V_^  ^USVW39}}}u3fEE4D0 tjWu @E 9}E}M+M ;Ms)ME uE @@ȍ+ʁ|̋+EjPWP40(tCEE;| E+E ;Er3E;9}tbj^9uuL} {0A0EǍMWQuu 0(t E}E0EuY,D0@t E 8 8+E_^[ hӸYL$At I AI AAAAaËD$;r3Ëȃ D@áVj^u;}ƣjP5Y Yu!jV5Y Yuj轧Y3ɸ  =X|3ɺ4tu AH|^<= t#ËD$;r=8w+PYà PËD$} PjYËD$ PËD$;r=8w+PYà PËD$} PyYËD$ PUSV WVP=T39 tVjYj[u uYE Yt jYV׋E _^[]UEu]Ã=$ ufM fw9jX]ÍMeQj5PE jPh 54 t}ts *]SVD$ uL$D$3؋D$ Aȋ\$T$D$ ud$ȋD$r;T$wr;D$ vN3ҋ^[SD$ uL$D$ 3D$3Pȋ\$T$ D$ ud$d$r;T$ wr;D$v+D$T$+D$T$ ؃[Ujh8hPdPd%SVWe< 3;u>EPj^VhVHtEPVhVSLjX< u$E;u$ uuu uPL9]u4 ESSuu E @PuE;tc]<ǃ$geuWSVw jXËe33M;t)uVuu ju;tuPVuH3e̋Md _^[Q=L$r-=s+ȋą@PUQ=$ SVWuEAZ ]j;^}%95~ VS&YY pX#ƅuepDJte jE] X e ]VjMjQPEPW5$  t;uE EM _^[USV WVP=T39 tVjYj[uu u Et j(YV׋E_^[]USVu 3;t9]t:uE;tf3^[]9$ uM;tffjX pDAtN~*9E|/39]QuPVj 54 u9Er8^uE *39]PujVj 54 xɋT$ L$tG3D$Wr-كt+шGIuʃttGJuD$_ËD$Ã=~jt$YYËD$ pAUQEHw pARV5pDV^teMEj eEjXM jjjQPEPjuE #E ̋D$L$ ȋL$ u D$S؋D$d$؋D$[̀@s sË333Vt$F @t F f F u VYFvvv FtotjV ‚u7NWt< ɍ<pO_ႀu V ~uN t uFHFA^ F f^S\$VtAt$F ut2u.~uVY;Fu ~u@F @t8t@^[F F$ F %jt$t$t$U SeVW}wu=~jPYY pÊAtFЀ-uuM+uFuE$wjYu$0t E 2t }w u,9uv'E"tME$ƉEtEEtE؉EE E t83_^[̍B[Í$d$3D$ST$t B8tфtQu WV ؋ ~333ƃu%t%uu^_[3ËB8t6t8t't8tt8tt^_B[ÍB^_[ÍB^_[ÍB^_[̋L$WSV|$tiqtOL$F8tt F8t u^[_3ÊF8u~at(8uĊAtf8t3^[_G^[_Ë^[_UWVSM&ً}3ˋu F3:GwtIIы[^_S39L VWuBht@;tg5DhhWօL tPhXWhDWP ֣T P tЋ؅tT tSЋt$t$t$SL _^[3U EeHSVHWtgHHtFtAt<t*tHtF` ` B\ \ 5d d (vPuYYX X jE{uYu}SõY3;u9Mtj諵YjEt tuVTUNTuIVXFXUu7 ;}(IVP d=A;|}tj+Y}u vXjYYuӃ} Yt}uE}FTuEFX3_^[ËT$ Vt$9rWt+~&WPv ;uF t$F N Ff_^[jYSVWj33g3Y95~t t_@ tYPV YYH t0|$uPYtC|$utPYu 4VYYF;5|jB|$Yt_^[jrYUV3PPPPPPPPU I tB$uA tF$s ^UV3PPPPPPPPU I tB$u t F$sF ^Vt$;5s@΋ Dt%WV t$t$V(VV_^  ^U e}S] VWEȃ4<ƊHHt@< tMSED0 EjPuR408u90j^;un l0m$PYUUL0D0t ; u $E ME;ME<< t CEI9MsE@8 uE^ CEsEjPEEjP408u 0uG}tAD0HtE< t CD1);] u } u jju } t CM9MGt0@u +] ]E3_^[S39$ uD$a|YzT [V WVP9 =TtVjĭYj[t$YD$t jYV׋D$_^[UQ=$ SuEaz ]}(=~ jSYY pXukpDJte E] j e ]jXMjjjQPEPh5$ ] tuE EM [Vt$WF @tf VVVK _^Vt$WF t4VVv }Ft P9fYf _^S\$;VWsr<Ã4D0tRSYD0t)SYP4u 03t0 S)Y _^[UWVSM u}  xuNAZ I& t! tFG8r8w8r8w8u Iu38 = j j$33ۋ t# tFGQPS؃ Y;u Iu3;t rX u jˋ[^_Vt$;5s8΋ DtWVvV(V _^ ^Vt$WVYt<tujjY;YtVYPu 03V1ƃY dt WY3_^Vt$F ttv蒎ff 3YFF^%\̍iZ̸HE̍MHl-̸̸X̸̋EPYøځ̸hŁ̸鵁̸饁̸p镁̸Ȼ酁̸ u̸xe̍ekZkOkм4ܾ (>L`p|nV>,"8FR\lz0FVfz2L`z Ŀ|gtI1COu56csm >>/@ @@eBiBBB4E E$EEvEzE4FFEEE50P (8PX700WP `h````ppxxxx(null)(null)VWWW__GLOBAL_HEAP_SELECTED__MSVCRT_HEAP_SELECTruntime error TLOSS error SING error DOMAIN error R6028 - unable to initialize heap R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data abnormal program termination R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point not loaded Microsoft Visual C++ Runtime Library Runtime Error! Program: ...ۆ "GetLastActivePopupGetActiveWindowMessageBoxAuser32.dllH:mm:ssdddd, MMMM dd, yyyyM/d/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec  8 hx ظ V  0HP x й (@pX   8H`    @Ph   l$ֿ,ܾ (>L`p|nV>,"8FR\lz0FVfz2L`z Ŀ|gtI1COulstrcpyAlstrlenAlstrcatAlstrcmpA,CloseHandlexDeleteFileAeWaitForSingleObjectJCreateFileAGetTempFileNameAGetTempPathAvWriteFileFormatMessageAZGetLastErrorKERNEL32.dllwsprintfAUSER32.dllShellExecuteExASHELL32.dllmsi.dllRtlUnwindGetCommandLineAGetVersionHeapFree2GetCurrentThreadId9TlsSetValue6TlsAlloc7TlsFreeSetLastError8TlsGetValueHeapAllocInitializeCriticalSectionvDeleteCriticalSectionEnterCriticalSection-LeaveCriticalSectionExitProcessGetCPInfoGetACP|GetOEMCPiWideCharToMultiByteQMultiByteToWideChar LCMapStringA!LCMapStringW1TerminateProcess/GetCurrentProcessSetHandleCountGetStdHandlePGetFileTypeGetStartupInfoAeGetModuleFileNameAFreeEnvironmentStringsAFreeEnvironmentStringsW?GetEnvironmentStringsAGetEnvironmentStringsWgGetModuleHandleABGetEnvironmentVariableAGetVersionExAHeapDestroyHeapCreateXVirtualFreeUVirtualAllocHeapReAllocIsBadWritePtrSetUnhandledExceptionFilterHeapSizeIsBadReadPtrIsBadCodePtrSetFilePointerInterlockedDecrement InterlockedIncrementGetStringTypeAGetStringTypeWGetProcAddress.LoadLibraryA SetStdHandleReadFileFlushFileBuffersjD6$0@&FZfSetAllUsers.dllPrintScrollableTextSetAllUsersSetTARGETDIR(:TUnhandled exception caught while attempting to print a ScrollableText control.Error while getting the contents of the ScrollableText control. Following is the SQL String used to get the character stream: '%s'.Failed to locate the ScrollableText control required for printing.Unhandled exception while building the SQL string used to print a ScrollableText Control.Failed to print ScrollableText Control because the SQL string used to search for the control was NULL.Failed to locate a ScrollableText control with the following SQL Query: '%s'MsiViewExecute failed for the following SQL Query: '%s'MsiDatabaseOpenView returned ERROR_INVALID_HANDLE.MsiDatabaseOpenView failed for the following SQL Query: '%s'SELECT * FROM `Control` WHERE `Type` = 'ScrollableText' AND `Dialog_` = '%s'Unhandled exception while finding which dialog contains the ScrollableText control.LicenseAgreementBy default, printing from the LicenseAgreement dialog because the property 'IS_PRINT_DIALOG' was not found.IS_PRINT_DIALOG found in the Property table with a value of '%s'.IS_PRINT_DIALOGUnhandled exception while getting the size of the buffer used to hold the text in the ScrollableText control.Error getting the size of the buffer used to hold the text in the ScrollableText control.Exception caught in CPrintRTF::GetScrollableTextRTF while attempting to print a ScrollableText control.MsiRecordGetString got NULL text from the record of the following SQL Query: '%s'MsiRecordString returned ERROR_MORE_DATA. MsiRecordGetString's DWORD buffer had a value of '%i'MsiRecordGetString failed while getting text from the record of the following SQL Query: '%s'Unhandled exception in CPrintRTF::PrintRTFStream().The function 'PrintScrollableText' from the 'ISPrint' custom action succeeded.ScrollableText was found, but an error occurred while attempting to print the stream. Following are the contents of the error stream: '%s'rtfISPrintLog%iNote%iISPrintLog%iNote0ISPrintLog0Note0; PrintStreamPrintFileWithShellExecuteWaitForSingleObject returned an error code while attempting to print.After waiting for 10 seconds, it appears the file is still printing. Because the file is still being accessed, this program will move on without deleting the file.ShellExecute failed.printCreateTempFileInvalid handle to file %s.GetTempFilePathAndNameGetTempFileName Failed. The file was to be created in '%s.'InsGetTempPath Failed.%s.%sWriteStreamToFileWriteFile returned 0.AppendFileNameToErrorThis error occurred while processing the file '%s'.An unhandled exception occurred in 'CPrintRuntime::%s'.ShellExecute returned: InstallShield - ISSetAllUsers (End)Closing DatabaseALLUSERS0%s %s %s %s %dSELECT * FROM `Upgrade` Opening DatabaseInstallShield - ISSetAllUsers (Begin) ALLUSERS=%sAssignmentTypeIS_MAJOR_UPGRADEYes %s %s %s %s ***Not Related*** %s %s %s %s ***Related***Prod      !"#$%&'()*+,-./0123456789:;<I?@ABCDF GHJKMNOPQRSTUVWXYZ[\]^_`abed{fghijklmnopqrstuvwxyz}|A~uctNameVersionStringLanguageTARGETDIRINSTALLDIR%u.%u.%u.%u; cDP   h `y!@~ڣ @ڣ AϢ[@~QQ^ _j21~ - ]] d8  h<ܳlDx4y$z((@@( x  zz ((((( H CCC.        ! 5A CPR S WY l m pr   )    xpdXPD@<840,($  0ض̶Ķ.         pPSTPDT\;Zx0Nm:Yw/Ml0 H`0LL4VS_VERSION_INFO 6 ?StringFileInfo040904B0CommentsPCompanyNameMacrovision Corporation@ FileDescriptionSetAllUsers6 FileVersion12.0.499748 InternalNameSetAllUsersz+LegalCopyrightCopyright (C) 2006 Macrovision Corporation(LegalTrademarksHOriginalFilenameSetAllUsers.dll<ProductNameInstallShield.ProductVersion12.0DVarFileInfo$Translation 000 1&1r111 2&2`222223Z3h33333 4!42494T4b44444565{55555&6u66667&777)8/858>8H8889 99]9h9o9999 ::F:::::::;;(;2;V;;;;<)>C>t>>>>>>>>??/?8??? 000G0111,2N22222O3T3Y3r33444445#5)5l5s5y5Y6q66777"8(8.848:8@8F8L8R8X8^8d8j8p8v8|8888888$99:M:;5><>@>D>H>L>P>T>X>>>>>>?%?@?G?L?P?T?q???????????0:0@0D0H0L0M11111 2 2:2I2223333333444'4A4O4W4]4445)585T5a5f55+616(7@7G7O7T7X7\7777777777772888<8@8D888888889+9]9d9h9l9p9t9x9|9999999-:8:?:Z:p:v:{:::::::?>D>n?s?@00w2|2T3\3v3|333333333444/494R444444?5D5c555555Y6667#7}77-8<8R89<:F;;;;:<?? ?????????P0 000)01090A0W0_0g0o0w00000001/1<1I1\1e1q111111 22!2&2.2E2Z2`2h2p2{22222222'31363;3@3Y3_333344+4I4W4d4t4444444556%626<6F6N6\6z6666'7=7p777N88888A9Y999;;<"??`s00001111273T3333334%4,4<4B4I4S4l4t4y444445 5+5?5q5x555555#6M6[6666666757E77777777738:888999::&:6:u:::;3;u;;;; <<<<<<< ====E=Q=Y=a=q========= >>(>O>^>>>>>>?%?,??>N>>?U?333333444V4445S5Y5m55d6j66667 77=7B7[77838O8g8{88889g9m9{9999u:::::J;;7,>5>Q>t>>>>>>???+000L0_0f0x0000000B1T11112>2p2x2~222 33<3B3I3|3334$434g5t5j66'7>7V7i7999: :::&:,:3:8:I:e:::::::::r;w;;;;?>9>F>K>X>d>?%?>???hA0T0001%111}222222333G3374G4y444D5J5X5555j6t66667)7A7Q7a7|77777777"8x11111111111122222(24222225666(646<6@677808D8P8X8888888899@9T9`9h999999:::,:P:d:p:x:::::;; ;(;X;l;x;;;;;;<<(<0<`>>>>>>>>>>>>? ???$?(?,?0?4?H???X2\2`2d2h2l2p2t2777 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|77777777777777777777777777778880 *H 01 0 +0h +7Z0X03 +70% <<<Obsolete>>>0!0 +fzZ.BA΂!W̄Z0N0 0  *H 01 0 UZA10U Western Cape10U Cape Town10U Thawte Consulting cc1(0&U Certification Services Division1!0UThawte Premium Server CA1(0& *H  premium-server@thawte.com0 030806000000Z 130805235959Z0U1 0 UZA1%0#U Thawte Consulting (Pty) Ltd.10UThawte Code Signing CA00  *H 0Ƹ'` ie~m,pw&W?0!h.K5 Jڈ ! G yLnTiL:A}d{cE``1n&$ԴP`Y00U00@U9070531/http://crl.thawte.com/ThawtePremiumServerCA.crl0U%0++0U0)U"0 010UPrivateLabel2-1440  *H v-4Es4܎k.\L}hי.ȵ͊I:[ mRve"gSS7F/{El@!]uvf0߂/ ۟r7MwHJ? U,$00-GߍRFCmH 10  *H 01 0 UZA10U Western Cape10U Durbanville10 U Thawte10U Thawte Certification10UThawte Timestamping CA0 031204000000Z 131203235959Z0S1 0 UUS10U VeriSign, Inc.1+0)U"VeriSign Time Stamping Services CA0"0  *H 0 ʲ }uNgadڻ30X~k6xw~o< hlʽR-H=]_/kLR`@~ ?Ǵ߇_zj1.G 1s W-x43h/Š*Ë!fXWou<&]'x1"ijGC_^|}bM "Vͮv M٠h;004+(0&0$+0http://ocsp.verisign.com0U00AU:0806420http://crl.verisign.com/ThawteTimestampingCA.crl0U% 0 +0U0$U0010U TSA2048-1-530  *H JkXD1y+LͰXn)^ʓR G'/8ɓN"b?7!Op18UN$ҩ'NzaA*^ݻ+>W~ +;R8'?J001i9u<p-~0  *H 0U1 0 UZA1%0#U Thawte Consulting (Pty) Ltd.10UThawte Code Signing CA0 060210000000Z 080220235959Z01 0 UUS10UIllinois10U Schaumburg1 0U Macrovision Corporation10U  ENGINEERING1 0UMacrovision Corporation0"0  *H 0 ϥú*)$ų$g 'dM*(Qa3wV#q.}6 ZߕN*yu%V{(U705031/-http://crl.thawte.com/ThawteCodeSigningCA.crl0U%0+ +70U000  +702+&0$0"+0http://ocsp.thawte.com0 `HB0  *H d0S?>S"W`'qs 7I5R.M5mJ>ox[^40 @¥47ͣ,rh~ԩZҦښ=;u|*D00 +)2 ^v0  *H 0S1 0 UUS10U VeriSign, Inc.1+0)U"VeriSign Time Stamping Services CA0 031204000000Z 081203235959Z0W1 0 UUS10U VeriSign, Inc.1/0-U&VeriSign Time Stamping Services Signer0"0  *H 0 P(HhzDfu]~ĸc&=C|8%Usu'iN \ *UV!a3kݣ7e S\|f5_EvNS \0"7LB U?R,z򢪍5]j=k㿖`@DQn*(P{J 0kX@( ~|vqiOG05!b<+َ*{\{❥o<1$0 0i0U1 0 UZA1%0#U Thawte Consulting (Pty) Ltd.10UThawte Code Signing CAi9u<p-~0 +0 *H  1  +70 +7 10  +70# *H  1!uDeDkQ0. +7 1 0http://www.macrovision.com0  *H \"7)1ǩæ!YnaYWDZa7d: l!޸Nm|/3~ׯd{o:~~* &b8?h,ǖO>?[X@rK$rfhՀ-:-fйZc[/(,J|,h#]>z)hRq`fCɱe]5A[>ouu+jTz0 *H  100g0S1 0 UUS10U VeriSign, Inc.1+0)U"VeriSign Time Stamping Services CA +)2 ^v0 *H Y0 *H  1  *H 0 *H  1 060517162125Z0 *H  1cMp?b0  *H ^/~HHOQe5YNOO7612RgAD^(;BH<>)Ǖnd {QV8<.$vTvFWwÓ%@(I" oH*1jFgo2Pq/<%PBPD;XlA@R>q%bF%%p*iKB()롓"|f_.\%P=s*CRH쵘}! SDsTU@HDED/;rD'C7CrDX@HDED;9BE8@HNED5H  @HMED&AD5HUUU[[[[[[[[!!""##%'(*,-.0123!!""##579;=?NNaacc@BCEHHHKKKLQQ7;XZZ]]^^__                                 $&&)+)+/&&&468:<>MO`bb`DGIJGIJDPSTVWY\Y\Y\Y\GGGGGGGGIIKKKKKMMMAAAAAAAAAFFFFFFRRRUUUUUUUUU[[[[[[[ddffffffuuuuuuQmmmmQ}}}}}QQQQQQQQQ n@BQQQQQQQQ}}}}}QQ}}}mmxzmQQQQQQQQQQQQQmmxzm@@Q@@QlQmmmmegijijiipppeijijieegggiegegiegiegggiiiiiiieeggggeggieggeggggieggpepiieggi{eivi{wyggieggggivi{wyiegegegegiiiegegpgiiiiidfhhkllortdllklddRhGGddhdhdFAUdUdRlkdGFdAhdFhldhVuhhVAfhdIAUhhhdFdFpldGdhlhhhnqs~|~||~S~|~|~|  >WWtt789<  !M !"#$%&'()*+,-./012345678yz{|}~܅݅ޅ߅ABCDEFGHIs†ÆĆ mnopqrstuvwxyz{|}~56789:;<=>?@AˆÈĈňƈLjȈɈʈˈ͈̈ΈψЈш҈ӈԈՈֈ׈؈وڈۈ܈݈ވ߈  !"#$%&'()+,-./0123456789:;<=>?@BCDEFGHKLMNabʼnƉlj)*+,-./013456789:;<=ŠÊĊŊƊNJȊɊʊˊ͊ΊϊЊъҊӊԊ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSUVWXYZ[\]^_`ghlopqtuvwxyz{|}~lmnopqrstuvwxyz{|}~     $%&()*+,-./01456789:;<=>?@ABCDEFGH       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    st                     ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : < AAA= ? ? ? ? ? ? ? ? ? [C E = $56Yt@ A F B D > > > > > > > > > @HNFhD=D3CBCx@HAxDBDAED1H@HCjDExE(H@H<BE H J ; G zM O Q S T V X Z \ ^ ` b d f h j l n p r t v x z | ~ S M O Q S R U W Y [ ] _ a c e ] i k m o q s u w y { }  %%%'''+++,,,---.......7788===@HDjEA(H >@HDED/H (@HBA:F ?  @HDpA:F @=!]Root directory property undefined: [2]Invalid table: [2]; Could not be linked as tree.Source paths not created. No path exists for entry [2] in Directory table.Target paths not created. No path exists for entry [2] in Directory table.No entries found in the file table.The specified Component name ('[2]') not found in Component table.The requested 'Select' state is illegal for this Component.The specified Feature name ('[2]') not found in Feature table.Invalid return from modeless dialog: [3], in action [2].Null value in a non-nullable column ('[2]' in '[3]' column of the '[4]' table.Invalid value for default folder name: [2].The specified File key ('[2]') not found in the File table.Could not create a random subcomponent name for component '[2]'.Bad action condition or error calling custom action '[2]'.Missing package name for product code '[2]'.Neither UNC nor drive letter path found in source '[2]'.Error opening source list key. Error: '[2]'Custom action [2] not found in Binary table stream.Custom action [2] not found in File table.Custom action [2] specifies unsupported type.The volume label '[2]' on the media you're running from does not match the label '[3]' given in the Media table. This is allowed only if you have only 1 entry in your Media table.Invalid database tablesAction not found: [2].The directory entry '[2]' does not exist in the Directory table.Table definition error: [2]Install engine not initialized.Bad value in database. Table: '[2]'; Primary key: '[3]'; Column: '[4]'Selection Manager not initialized.Directory Manager not initialized.Bad foreign key ('[2]') in '[3]' column of the '[4]' table.Invalid reinstall mode character.Custom action '[2]' has caused an unhandled exception and has been stopped. This may be the result of an internal error in the custom action, such as an access violation.Generation of custom action temp file failed: [2].Could not access custom action [2], entry [3], library [4]Could not access VBScript run time for custom action [2].Could not access JavaScript run time for custom action [2].Custom action [2] script error [3], [4]: [5] Line [6], Column [7], [8].Configuration information for product [2] is corrupt. Invalid info: [2].Marshaling to Server failed: [2].Could not execute custom action [2], location: [3], command: [4].EXE failed called by custom action [2], location: [3], command: [4].Transform [2] invalid for package [3]. Expected language [4], found language [5].Transform [2] invalid for package [3]. Expected product [4], found product [5].Transform [2] invalid for package [3]. Expected product version < [4], found product version [5].Transform [2] invalid for package [3]. Expected product version <= [4], found product version [5].Transform [2] invalid for package [3]. Expected product version == [4], found product version [5].Transform [2] invalid for package [3]. Expected product version >= [4], found product version [5].Transform [2] invalid for package [3]. Expected product version > [4], found product version [5].Could not open transform [2] stored as child storage of package [4].The File '[2]' is not marked for installation.The File '[2]' is not a valid patch file.Server returned unexpected error [2] attempting to install package [3].The property '[2]' was used as a directory property in one or more tables, but no value was ever assigned.Could not create summary info for transform [2].Transform [2] does not contain an MSI version.Transform [2] version [3] incompatible with engine; Min: [4], Max: [5].Transform [2] invalid for package [3]. Expected upgrade code [4], found [5].Cannot begin transaction. Global mutex not properly initialized.Cannot write script record. Transaction not started.Cannot run script. Transaction not started.Assembly name missing from AssemblyName table : Component: [4].The file [2] is an invalid MSI storage file.No more data{ while enumerating [2]}.Transform in patch package is invalid.Custom Action [2] did not close [3] MSIHANDLEs.Cached folder [2] not defined in internal cache folder table.Upgrade of feature [2] has a missing component.New upgrade feature [2] must be a leaf feature.Unknown Message -- Type [2]. No action is taken.No publisher is found for the event [2].Dialog View did not find a record for the dialog [2].On activation of the control [3] on dialog [2] CMsiDialog failed to evaluate the condition [3].The dialog [2] failed to evaluate the condition [3].The action [2] is not recognized.Default button is ill-defined on dialog [2].On the dialog [2] the next control pointers do not form a cycle. There is a pointer from [3] to [4], but there is no further pointer.On the dialog [2] the next control pointers do not form a cycle. There is a pointer from both [3] and [5] to [4].On dialog [2] control [3] has to take focus, but it is unable to do so.The event [2] is not recognized.The EndDialog event was called with the argument [2], but the dialog has a parent.On the dialog [2] the control [3] names a nonexistent control [4] as the next control.ControlCondition table has a row without condition for the dialog [2].The EventMapping table refers to an invalid control [4] on dialog [2] for the event [3].The event [2] failed to set the attribute for the control [4] on dialog [3].In the ControlEvent table EndDialog has an unrecognized argument [2].Control [3] on dialog [2] needs a property linked to it.Attempted to initialize an already initialized handler.Attempted to initialize an already initialized dialog: [2].No other method can be called on dialog [2] until all the controls are added.Attempted to initialize an already initialized control: [3] on dialog [2].The dialog attribute [3] needs a record of at least [2] field(s).The control attribute [3] needs a record of at least [2] field(s).Control [3] on dialog [2] extends beyond the boundaries of the dialog [4] by [5] pixels.The button [4] on the radio button group [3] on dialog [2] extends beyond the boundaries of the group [5] by [6] pixels.Tried to remove control [3] from dialog [2], but the control is not part of the dialog.Attempt to use an uninitialized dialog.Attempt to use an uninitialized control on dialog [2].The control [3] on dialog [2] does not support [5] the attribute [4].The dialog [2] does not support the attribute [3].Control [4] on dialog [3] ignored the message [2].The next pointers on the dialog [2] do not form a single loop.The control [2] was not found on dialog [3].The control [3] on the dialog [2] cannot take focus.The control [3] on dialog [2] wants the winproc to return [4].The item [2] in the selection table has itself as a parent.Setting the property [2] failed.Error dialog name mismatch.No OK button was found on the error dialog.No text field was found on the error dialog.The ErrorString attribute is not supported for standard dialogs.Cannot execute an error dialog if the Errorstring is not set.The total width of the buttons exceeds the size of the error dialog.SetFocus did not find the required control on the error dialog.The control [3] on dialog [2] has both the icon and the bitmap style set.Tried to set control [3] as the default button on dialog [2], but the control does not exist.The control [3] on dialog [2] is of a type, that cannot be integer valued.Unrecognized volume type.The data for the icon [2] is not valid.At least one control has to be added to dialog [2] before it is used.Dialog [2] is a modeless dialog. The execute method should not be called on it.On the dialog [2] the control [3] is designated as first active control, but there is no such control.The radio button group [3] on dialog [2] has fewer than 2 buttons.Creating a second copy of the dialog [2].The directory [2] is mentioned in the selection table but not found.The data for the bitmap [2] is not valid.Test error message.Cancel button is ill-defined on dialog [2].The next pointers for the radio buttons on dialog [2] control [3] do not form a cycle.The attributes for the control [3] on dialog [2] do not define a valid icon size. Setting the size to 16.The control [3] on dialog [2] needs the icon [4] in size [5]x[5], but that size is not available. Loading the first available size.The control [3] on dialog [2] received a browse event, but there is no configurable directory for the present selection. Likely cause: browse button is not authored correctly.Control [3] on billboard [2] extends beyond the boundaries of the billboard [4] by [5] pixels.The dialog [2] is not allowed to return the argument [3].The error dialog property is not set.The error dialog [2] does not have the error style bit set.The dialog [2] has the error style bit set, but is not an error dialog.The help string [4] for control [3] on dialog [2] does not contain the separator character.The [2] table is out of date: [3].The argument of the CheckPath control event on dialog [2] is invalid.On the dialog [2] the control [3] has an invalid string length limit: [4].Changing the text font to [2] failed.Changing the text color to [2] failed.The control [3] on dialog [2] had to truncate the string: [4].The binary data [2] was not foundOn the dialog [2] the control [3] has a possible value: [4]. This is an invalid or duplicate value.The control [3] on dialog [2] cannot parse the mask string: [4].Do not perform the remaining control events.CMsiHandler initialization failed.Dialog window class registration failed.CreateNewDialog failed for the dialog [2].Failed to create a window for the dialog [2].Failed to create the control [3] on the dialog [2].Creating the [2] table failed.Creating a cursor to the [2] table failed.Executing the [2] view failed.Creating the window for the control [3] on dialog [2] failed.The handler failed in creating an initialized dialog.Failed to destroy window for dialog [2].[2] is an integer only control, [3] is not a valid integer value.The control [3] on dialog [2] can accept property values that are at most [5] characters long. The value [4] exceeds this limit, and has been truncated.Loading RICHED20.DLL failed. GetLastError() returned: [2].Freeing RICHED20.DLL failed. GetLastError() returned: [2].Executing action [2] failed.Failed to create any [2] font on this system.For [2] textstyle, the system created a '[3]' font, in [4] character set.Failed to create [2] textstyle. GetLastError() returned: [3].Invalid parameter to operation [2]: Parameter [3].Operation [2] called out of sequence.The file [2] is missing.Could not BindImage file [2].Could not read record from script file [2].Missing header in script file [2].Could not create secure security descriptor. Error: [2].Could not register component [2].Could not unregister component [2].Could not determine user's security ID.Could not remove the folder [2].Could not schedule file [2] for removal on restart.No cabinet specified for compressed file: [2].Source directory not specified for file [2].Script [2] version unsupported. Script version: [3], minimum version: [4], maximum version: [5].ShellFolder id [2] is invalid.Exceeded maximum number of sources. Skipping source '[2]'.Could not determine publishing root. Error: [2].Could not create file [2] from script data. Error: [3].Could not initialize rollback script [2].Could not secure transform [2]. Error [3].Could not unsecure transform [2]. Error [3].Could not find transform [2].Windows Installer cannot install a system file protection catalog. Catalog: [2], Error: [3].Windows Installer cannot retrieve a system file protection catalog from the cache. Catalog: [2], Error: [3].Windows Installer cannot delete a system file protection catalog from the cache. Catalog: [2], Error: [3].Directory Manager not supplied for source resolution.Unable to compute the CRC for file [2].BindImage action has not been executed on [2] file.This version of W-!LY(A6/.!  g5c#<35K,3-%E(6D>:`54;F"2@6AIGV3&0JJ#B;>8N+;@:,8+3*-@F"";!2:9;GH!ADQOabbbaD.)Gj0.GL@4+?,%&/=//0(5_4!,qG RVFXLE87;MJABXxW'6E22>,4>; +,@=D?I]J'EOfB)D)+Vi^9%;G["EJ%&>!c@,"(*-3*=5(A::-I=2%+"8!#' 3.,`:07)*,\lj5'3kindows does not support deploying 64-bit packages. The script [2] is for a 64-bit package.GetProductAssignmentType failed.Installation of ComPlus App [2] failed with error [3].The patches in this list contain incorrect sequencing information: [2][3][4][5][6][7][8][9][10][11][12][13][14][15][16].Patch [2] contains invalid sequencing information. Could not connect to [2] '[3]'. [4]Error retrieving version string from [2] '[3]'. [4]SQL version requirements not met: [3]. This installation requires [2] [4] or later.Could not open SQL script file [2].Error executing SQL script [2]. Line [3]. [4]Connection or browsing for database servers requires that MDAC be installed.Error installing COM+ application [2]. [3]Error uninstalling COM+ application [2]. [3]Error installing COM+ application [2]. Could not load Microsoft(R) .NET class libraries. Registering .NET serviced components requires that Microsoft(R) .NET Framework be installed.Could not execute SQL script file [2]. Connection not open: [3]Error beginning transactions for [2] '[3]'. Database [4]. [5]Error committing transactions for [2] '[3]'. Database [4]. [5]This installation requires a Microsoft SQL Server. The specified server '[3]' is a Microsoft SQL Server Desktop Engine or SQL Server Express.Error retrieving schema version from [2] '[3]'. Database: '[4]'. [5]Error writing schema version to [2] '[3]'. Database: '[4]'. [5]This installation requires Administrator privileges for installing COM+ applications. Log on as an administrator and then retry this installation.The COM+ application "[2]" is configured to run as an NT service; this requires COM+ 1.5 or later on the system. Since your system has COM+ 1.0, this application will not be installed.Error updating XML file [2]. [3]Error opening XML file [2]. [3]This setup requires MSXML 3.0 or higher for configuring XML files. Please make sure that you have version 3.0 or higher.Error creating XML file [2]. [3]Error loading servers.Error loading NetApi32.DLL. The ISNetApi.dll needs to have NetApi32.DLL properly loaded and requires an NT based operating system.Server not found. Verify that the specified server exists. The server name can not be empty.Unspecified error from ISNetApi.dll.The buffer is too small.Access denied. Check administrative rights.Invalid computer.Undefined switch case.Unhandled exception.Invalid user name for this server or domain.The case-sensitive passwords do not match.The list is empty.Access violation.Error getting group.Error adding user to group. Verify that the group exists for this domain or server.Error creating user.ERROR_NETAPI_ERROR_NOT_PRIMARY returned from NetAPI.The specified user already exists.The specified group already exists.Invalid password. Verify that the password is in accordance with your network password policy.Invalid name.Invalid group.The user name can not be empty and must be in the format DOMAIN\Username.Error loading or creating INI file in the user TEMP directory.ISNetAPI.dll is not loaded or there was an error loading the dll. This dll needs to be loaded for this operation. Verify that the dll is in the SUPPORTDIR directory.Error deleting INI file containing new user information from the user's TEMP directory.Error getting the primary domain controller (PDC).Every field must have a value in order to create a user.ODBC driver for [2] not found. This is required to connect to [2] database servers.Error creating database [4]. Server: [2] [3]. [5]Error connecting to database [4]. Server: [2] [3]. [5]Error attempting to open connection [2]. No valid database metadata associated with this connection.You are trying to install Adobe Flash Player 9 on an unsupported operating system. Adobe Flash Player 9 is supported on Windows 98, Windows Me, Windows 2000, Windows XP, and later.[SystemFolder]ActionDataProgressActionProgress95AdminInstallFinalizeSetProgressSelectionDescriptionItemDescriptionSelectionPathLocationSelectionSizeYou must have administrative privileges to install Flash Player 9. Please log on with administrative privileges and try again.(Version9X>=410) Or (VersionNT>=500)&Anyone who uses this computer (all users)AdminUserbytesGBKBThis feature will not be available.MBAbsentPathThis feature will be installed when required.MenuAbsentThis feature, and all subfeatures, will be installed to run from the CD.MenuAdvertiseThis feature, and all subfeatures, will be installed on local hard drive.MenuAllCDThis feature, and all subfeatures, will be installed to run from the network.MenuAllLocalThis feature will be installed to run from CD.MenuAllNetworkThis feature will be installed on local hard drive.MenuCDThis feature will be installed to run from network.MenuLocalThis feature will remain uninstalled.MenuNetworkThis feature will be set to be installed when required.SelAbsentAbsentSelAbsentAdvertiseThis feature will be installed on the local hard drive.SelAbsentCDThis feature will be installed to run from the network.SelAbsentLocalThis feature will become unavailable.SelAbsentNetworkWill be installed when required.SelAdvertiseAbsentThis feature will be available to run from CD.SelAdvertiseAdvertiseThis feature will be installed on your local hard drive.SelAdvertiseCDThis feature will be available to run from the network.SelAdvertiseLocalThis feature will be uninstalled completely, and you won't be able to run it from CD.SelAdvertiseNetworkThis feature was run from the CD but will be set to be installed when required.SelCDAbsentThis feature will continue to be run from the CDSelCDAdvertiseThis feature was run from the CD but will be installed on the local hard drive.SelCDCDThis feature frees up [1] on your hard drive.SelCDLocalThis feature requires [1] on your hard drive.SelChildCostNegCompiling cost for this feature...SelChildCostPosThis feature will be completely removed.SelCostPendingThis feature will be removed from your local hard drive but will be set to be installed when required.SelLocalAbsentThis feature will be removed from your local hard drive but will still be available to run from CD.SelLocalAdvertiseThis feature will remain on your local hard drive.SelLocalCDThis feature will be removed from your local hard drive, but will be still available to run from the network.SelLocalLocalThis feature will be uninstalled completely, and you won't be able to run it from the network.SelLocalNetworkThis feature was run from the network but will be installed when required.SelNetworkAbsentThis feature was run from the network but will be installed on the local hard drive.SelNetworkAdvertiseThis feature will continue to be run from the networkSelNetworkLocalThis feature frees up [1] on your hard drive. It has [2] of [3] subfeatures selected. The subfeatures free up [4] on your hard drive.SelNetworkNetworkThis feature frees up [1] on your hard drive. It has [2] of [3] subfeatures selected. The subfeatures require [4] on your hard drive.SelParentCostNegNegThis feature requires [1] on your hard drive. It has [2] of [3] subfeatures selected. The subfeatures free up [4] on your hard drive.SelParentCostNegPosThis feature requires [1] on your hard drive. It has [2] of [3] subfeatures selected. The subfeatures require [4] on your hard drive.SelParentCostPosNegTime remaining: {[1] min }[2] secSelParentCostPosPosAvailableTimeRemainingDifferencesVolumeCostAvailableRequiredVolumeCostDifferenceDisk SizeVolumeCostRequiredVolumeVolumeCostSizeVolumeCostVolume9.9.0.06.0.47.0{91ACC36E-CB92-44F0-AF4E-0BACC033F7F1}This is the primary key to the ISDIMDependency tableISDIMReference_ISDIMDependencythe UUID identifying the required DIMRequiredUUIDthe major version identifying the required DIMRequiredMajorVersionthe minor version identifying the required DIMRequiredMinorVersionthe build version identifying the required DIMRequiredBuildVersionthe revision version identifying the required DIMRequiredRevisionVersionFull path, the category is of Text instead of Path because of potential use of path variables.ISBuildSourcePathISDIMReferenceThis is the primary key to the ISDIMReference tableForeign key into ISDIMReference table.ISDIMReference_ParentISDIMReferenceDependenciesForeign key into ISDIMDependency table.ISDIMDependency_Name of a variable defined in the .dim fileISDIMVariableType of the variable. 0: Build Variable, 1: Runtime VariableThis is the primary key to the ISDIMVariable tableNew value that you want to override withNewValueISFeatureDIMReferencesAS Repository property nameISReleaseASPublishInfoAS Repository property valueForeign key into the ISProductConfiguration table.ISProductConfigurationISProductConfiguration_Foreign key into the ISRelease table.ISReleaseISRelease_ Custom Action Information

Custom Action Information

Action Name

CheckForProductUpdates

Type

226

Description

Uses the Update Service to check for product updates.

Custom Action Information

Custom Action Information

Action Name

CheckForProductUpdatesOnReboot

Type

226

Description

Uses the Update Service to check for product updates on reboot.

Custom Action Information

Custom Action Information

Action Name

ISSetAllUsers

Type

257

Description

Sets ALLUSERS per upgrade or initial installation requirements.

Custom Action Information

Custom Action Information

Action Name

SetARPINSTALLLOCATION

Type

51

Description

Resolves the directory identifier used in the Add or Remove Programs Read Me property. This custom action is required because ARPREADME is a Windows Installer property and such properties are not formatted automatically.

TailBitmapBannerLineBannerLine{&Tah 6x3#3S#-L*,?=>D? x \$+,*S4"#^ I>W28S16d      ~$* # - H I M .33 % 77 7% .87UO 0O- -"(fc2 m ^JT5!    &4% ...1^3&'+ <2(2%  TfU1    ! e /F   ? oma8}InstallShieldBranding1Branding2ComboTextBrowse to the destination folder.PushButton&Folder name:DirectoryComboCombo{&MSSansBold8}Change Current Destination FolderDlgLineTailTextDisk space required for the installation exceeds available disk space.DirectoryListListUp one level|&Look in:PathEditCreate new folder|{&MSSWhiteSerif8}InstallShieldSpecify a network location for the server image of the product.The InstallShield(R) Wizard will create a server image of [ProductName] at a specified network location. To continue, click Next.&Network location:SetupPathEdit{&MSSansBold8}Network LocationEnter the network location or click Change to browse to a location. Click Install to create a server image of [ProductName] at the specified network location or click Cancel to exit the wizard.LBBrowse< &BackImage{&TahomaBold10}Welcome to the InstallShield Wizard for [ProductName]TextLine1&Next >TreeSelect the program features you want installed.&SpaceInstall to:{&MSSansBold8}Custom Setup&Change...Click on an icon in the list below to change how a feature is installed.GroupBoxFeatureGroupFeature sizeFeature DescriptionMultiline description of the currently selected item_BrowsePropertySelectionTreeNameEdit{&MSSansBold8}Custom Setup TipsDontInstallWill be installed on first use. (Available only if the feature supports this option.)DontInstallTextThis install state means the feature...FirstInstallTextInstallInstallFirstUseInstallPartialInstallStateMenuThe icon next to the feature name indicates the install state of the feature. Click the icon to drop down the install state menu for each feature.InstallStateTextCustom Setup allows you to selectively install program features.Will be installed to run from the network. (Available only if the feature supports this option.)MenuTextNetworkInstallWill have some subfeatures installed to the local hard drive. (Available only if the feature has subfeatures.)NetworkInstallTextWill not be installed.PartialTextPlease enter your information.Click Next to install to this folder, or click Change to install to a different folder.NameLabel&Organization:COMPANYNAMEEditCompanyEditCompanyLabel{&MSSansBold8}Customer Information&Serial Number:&User Name:USERNAME{\Tahoma8}{80}{\Tahoma8}{50}RadioButtonGroupInstall this application for:ISX_SERIALNUMMaskedEdit{&MSSansBold8}Database FolderLocLabelInstall [ProductName] database to:[DATABASEDIR]The InstallShield(R) Wizard will install [ProductName] on your computer. To continue, click Next.{&MSSansBold8}Destination FolderSome files that need to be updated are currently in use.Install [ProductName] to:{&MSSansBold8}Disk Space RequirementsVolumeCostList{&MSSansBold8}Files in Use&ExitThe following applications are using files that need to be updated by this setup. Close these applications and click Retry to continue.FileInUseProcessThe disk space required for the installation of the selected features.Up One Level|Create New Folder|&InstallWARNING: This program is protected by copyright law and international treaties.AgreePlease read the following license agreement carefully.Repair, or remove the program.{&MSSansBold8}License Agreement{\rtf1\ansi\ansicpg1252\uc1 \deff0\deflang1033\deflangfe1033{\fonttbl{\f0\froman\fcharset0\fprq2{\*\panose 02020603050405020304}Times New Roman{\*\falt Times};}{\f1\fswiss\fcharset0\fprq2{\*\panose 00009002190190021901}Arial;} {\f3\froman\fcharset2\fprq2{\*\panose 0000f800000005200000}Symbol;}{\f6\fmodern\fcharset0\fprq1{\*\panose 00000000000000000000}Courier;}{\f15\fswiss\fcharset0\fprq2{\*\panose 020b0604030504040204}Tahoma;} {\f25\froman\fcharset238\fprq2 Times New Roman CE{\*\falt Times};}{\f26\froman\fcharset204\fprq2 Times New Roman Cyr{\*\falt Times};}{\f28\froman\fcharset161\fprq2 Times New Roman Greek{\*\falt Times};} {\f29\froman\fcharset162\fprq2 Times New Roman Tur{\*\falt Times};}{\f30\froman\fcharset186\fprq2 Times New Roman Baltic{\*\falt Times};}{\f31\fswiss\fcharset238\fprq2 Arial CE;}{\f32\fswiss\fcharset204\fprq2 Arial Cyr;} {\f34\fswiss\fcharset161\fprq2 Arial Greek;}{\f35\fswiss\fcharset162\fprq2 Arial Tur;}{\f36\fswiss\fcharset186\fprq2 Arial Baltic;}{\f115\fswiss\fcharset238\fprq2 Tahoma CE;}{\f116\fswiss\fcharset204\fprq2 Tahoma Cyr;} {\f118\fswiss\fcharset161\fprq2 Tahoma Greek;}{\f119\fswiss\fcharset162\fprq2 Tahoma Tur;}{\f120\fswiss\fcharset186\fprq2 Tahoma Baltic;}}{\colortbl;\red0\green0\blue0;\red0\green0\blue255;\red0\green255\blue255;\red0\green255\blue0; \red255\green0\blue255;\red255\green0\blue0;\red255\green255\blue0;\red255\green255\blue255;\red0\green0\blue128;\red0\green128\blue128;\red0\green128\blue0;\red128\green0\blue128;\red128\green0\blue0;\red128\green128\blue0;\red128\green128\blue128; \red192\green192\blue192;}{\stylesheet{\widctlpar\adjustright \fs20\cgrid \snext0 Normal;}{\s1\keepn\nowidctlpar\outlinelevel0\adjustright \b\f1\fs16 \sbasedon0 \snext0 heading 1;}{\*\cs10 \additive Default Paragraph Font;}{\s15\nowidctlpar\adjustright \f6\fs16\cf6 \sbasedon0 \snext15 Body Text;}}{\*\listtable{\list\listtemplateid67698689\listsimple{\listlevel\levelnfc23\leveljc0\levelfollow0\levelstartat1\levelspace0\levelindent0{\leveltext\'01\u-3913 ?;}{\levelnumbers;}\f3\fbias0 \fi-360\li360 \jclisttab\tx360 }{\listname ;}\listid143089650}{\list\listtemplateid67698703\listsimple{\listlevel\levelnfc0\leveljc0\levelfollow0\levelstartat1\levelspace0\levelindent0{\leveltext\'02\'00.;}{\levelnumbers\'01;}\fi-360\li360\jclisttab\tx360 }{\listname ;}\listid461312141}{\list\listtemplateid67698689\listsimple{\listlevel\levelnfc23\leveljc0\levelfollow0\levelstartat1\levelspace0\levelindent0{\levelBBBvvBB$$$$Bvv22F F`BBBBvvBBBvvBBBvvBBBvvBB$$FBvv22FBBBBBBBȀBxBB$$hBBhBx#vv22F܀BB$$m,,Bvv22FKKBB$$Bvv22FJfBB$$F$$Bvv22vJBB$$B/ڀڀ0Bvv22FNXWY€BBBB$$FBBvv22FJdB$$BLvv22cFcL$$FBvv22FL,$$Bvv22F,,,,,,BB$$"Bvv22FB$$BLvv22cFcL$$fBvv22FfBB$$BBvv22F"BB$$BBvv22F"$$\BBBvv22FKBBB22v]BB$$FJBvv22FJB$$\Bvv22FKWBB22--22--   -----$ -22-  ,  -I-2------ x, ##22  2, vx 2,   , (,   , P"((,  , P a+, x,  $, ##, P a), }(, (, ,  Ӏ, , ( PPPP P88PPPPPPXX88 ?PPGGGGGGGGGIIIIIIIKKKKKKKMMMMMMMMAAAAAAAAAAAAAAAAAAAAFFFFFFFFFFFFFFFFFFRRRRRRRRRRRRUUUUUUUUUUUUUU[[[[[[[[[[[[[[[[[[[[ddddffffffffffffffuuuuuuuuuuuuuuuu%Q  !"#%  %'(*,-.0123m  %Q=  !"#%  579;=?Q? % ' ) + - %NQ}  %Q  %Q  Qac  579KQ 9 : < = n  [579@BCQC E   57EHKLQ % ? D F 57Q 579;X} 57QZ]^_ z579}  57mxz 579 57m ( * , - . / 0 2 5 6 8 ; 57KQ 57mxz 579m 57@QE Z 57@QE Z 579l Q  579= 579m m     ```          z         O  zz z      $  O R  C C    O     C C   O z         k   zzzzzz O  zz      k  z  z      ?       ?O  ?--怇--怇-怇;- ; ;;0;;----怇- 0P"P"2- -]0- ?0- 0-  0- +\\+-00>- 0- 6O0 -0< -0<<2<<- 0##PP- 6O0 -0- -909- -909 -怤0-0 - 0- 0€}0 7PP77rp7Pxm7}PP7d33q,ꀋU37767.3O,^^PPPPPPP󀅀3ˀ󀾀Pˀ,FC,?4dY,ꀾ73,FЀЀj,j\2993|,fZBBπ,2@Z3,_i,ꀛi4[4̀̀7,ffBBπ,2@Z,7A4A,44AA,43,W 3f,O3,B-BBBFvBBBvvBB ƀƀBvv܀BBBvvs # Q K B  VVVV# # # # # s s                 " # ! (   $ & *  ]       / 0 1  4 > @  A 8 ;            !    < G I P  M J L A       ;      m  m 3 & m 9 )    + 1 4 7     m  { g m  = W  \  [  = a   d c n p o     c n m m Q m'QNQ}QQQKQB Q@? QLKF % ED Q} Q^Z]  _  } z m x KQ z m x @Q@Q lQ m m } s  D D J pO i <""''""KBGGI H I C G P Q M N K L R GIKMAFRU[dfu@HCED;H "@HA'C:ED1H#@H CCB ; ' C1A5G<?EDAC2222222222222222222222222222222222222222222 22222222222222222222vvvvvvvvvvvvvvvvvvvvvvvvvvvvv n U ## 3 Qm}QQQK  % } } mK mQQQm Qm}QQQQQQQ}Q}mmQmmQQQmmmmmlE F  \,s,%o "p555666<<????BBBBBQQQQQQbbbEEEEEEEEEVVVVVhhkkkkkkk{{{{{{{{{{M{>qP%.= ft8W_0_z!E3;{PW83 Rًq/_Cua,hN>uHUQ!;G|d ;'Vd|ou9tK0\se3gP3nlP.PM#â_s,C48 S\G},)c-RăW8 `8Qܷ/}qu/ -S8RG]W_|4.B$p h.p.B{p^}[ƁFy5ITHP1 JXx8XQus gMwIGIPlOp Ay@6C8WS7|+5V`M{԰0~!K&57zC{(>x>#W2tY?'1[[o ;F\Tȃ#Q:վk)8^?$ISGjwQH$pE+ٰ_ 7p% ,:s݋tǰ^ÍQ3Cu tc|pj0xYM '3t:P91Lz%]?}t9] U*~>%& P,/eB } 4ҭ_( S jfG,$Y :Wvt>^a[f׈[F w$ejċy9C4 dY<;p)\&?v  C z(QVVO,₮j1}QIsIӻQ!vկY{;Y$b ۻ}u 5% 9ca#FkGӪGAvb4hQ%7n$"{tT7ヶ-}ug0]>f: :?@Wl[>@1-( $ 1B,]9J"BF'S<܉!{-3pȽ%XjYjV8F\TG%>(t~GvŌ؅\=R;Ʌwõܺ_ĉTu-gQCDAApt)aScYRRfaߍ8PPSK Sy3m{5#6GU399Fk8h?$Q|@PPfSbѷ!JB9u+͈BNČ uM ;DN N~ t C ;!t+tj3Tw(Wp68aԌR$)w Oi≌!t`#y v8 >+.\s|;^A~{ kM@UY&- j# `@FjC807R7)Q SSc>E $x ,pWQрD}o aԇv P£6SUFýNG-S@S<;~v'dGW)A[[رY_nv@d. E^]E)G^;v9 8=;W7|1Fc ʋsVKHw{B^T+B;wwC0;ދ߅(S+Z_0AMf f I6!/H c R}q _+;{ucz`pR܅##C+Wp(KHWP.;PBxot(Eq`Bv| ʯ_ \$  vsHSo ~W%_VB]LPxKu3~ c *9^`sb)ċ+P1}u!.m-2E35v?;u;Nxs)[S5CO\ދOK wCR5MZ@ !L!This program cannot be run in DOS mode. $񎀔 ៞៟ТTjt途IqRichPELg6E! p@ P;pppK UPX0UPX1pp@.rsrc@<t@1.24UPX!  qu{m&" (" P.WF];ASWRPkQ hWP[{=l& =V cv o_^[d <;,39_}j 0>vUȠY~`ڙO] ?G}SVW/;} fG]4)S7\5S V#ϲPQ9] Wut ?hF `x?qNS=B^Oc@t0m [dP>Eu p~E` GW (BkAupPsW|$CW.~W'L$Ft@@AAJu[.~N0$xԂ^?\v aAw3;t A:‚t<[;uMR#Αh2F(8TtbV+ {wsCq9~ sW UWm>pGwjw? v$wRCvUMuԲTN[}`9 w# ]Mـ |w8 Y1|4{S\$%t$~W}Y7jo/vW6Y_/dV1~V%W؇ #OrtKyߍF#%7wu3#2\0w&A =I qN<@D$[(i'OQQ*ݙ 4ћt~ kuX5=  P֑Y20p;ugGt.c]CN,t" z\ƩM4Wf}+ecvU 8LXW#ǒ@YA9up;Quma@ ;? |PDsanXSC~Xx4t޽#UH4؉]P\؝ C\0KGD\f)#~(>!+@0 O]ۉeG+#C0fv|3W 8y ,2PSE g28Nvr[P ؋C,@Q8 6N K  }vEm P#{%6woW>nVf} x O,BHV_<$2f=ԃ} >`΋|(YN!uW6# ^WLc 6WfH܉9^ ܫ_]7O·]P v,3^#udܬqJ>;Ա|R_8ښ|W³'h2k: |G7 rA?; y@ XW9};v79suZw:4;}509)VubA:O5EӛV ,>/ E+1u h-:uW'&:Jإr*y 39}|u-a҉>W ?-5WQ{s, x{SR Q4 )[;UK,V`8/ƨf 0dT$m'*jE8XvT8# Ñi=22 Q(>jj^w Z9!]n{hf\< >t;tm:tiURڌ ;jx5x/ށ)#Sć-}Nݗ QYo@7[D_΅FT(n'Er=u78_Qu$|C_WP N`r}"e;Y1-jؒY5p詡#Ņqx?GQVܾz$~L:t[URSSƏ>SQ=>(,Xcu}WeShQP3l3Z]|,%… f;g/h k6H2 +Rl5 Q8sc&ט}W!gYN(is+q39O(dKeϜj[-`eS88C`谝cPM#jiZM;t A4x`>]C.u/A:~qDeU?*vTTSw2}-UaS>֕mPwWŴTLD@^@b{U!e`C_XZc;8YӮ2q_.V 2P\"I8K,8JCspk!ҋ_;wuPU +NTX̥8zM~x17_}ui3 ;q[@AAw*8tFgtc `Wo{]Uc1 F$)K9[G(9Cm{tW8o8PgO8&pJK3 q1qR+9:u$9 u 낿;ڋSM5aQz'83%]uJ/`^;t_Mv}_9x8 ;P%;`9~(0u4;Ou ˃`sk 8uF>0eÞdUSnsL>8|4׉3qphjIG`>"!<ж)hk}x:{8!`xN x6JPY_OT3 􏮅V 0f;1u w(\%^'^$^;=^-`%#< cOp/Q_tYuׁ Cjc} O1vB%Ӂs0ZݎGG/Xg,|E;} u>t[_o(Whп`C$H O2( 2hnGlVM3W賄@Z+I0` x,'0NsXz`'Q'N3?Kxo7yG,0M?C 6!B6@vHs}bu!3ױ yz ҫh|p3?:8 YV;Wu "6?9u u99u"A FunZk}G3…҉UU7.u5 ;W-W ^G;t.SWfzp/.#A e9WV϶3+KQ(4 V7L!K r25r\2):BC55Ĵ#rH^<ӐD.kiV0~}Zp hV60SN@:<}YKhlpxVK[<|Ɔ NZv@'o)e#4),MG΃(G>t ( y W l I@3Ɉڿ~݈H P H@|p5)5 $\82fmX<x4NAG|B'kF]`tۃd]011^U5aNNxaa[7B ޾FL ߰^L)mujt#C!8N q , a!qZU1no5/d:054T 6);xA &PD-鞾Y0q7/ADaRu;wªgFukNw'af2[HLL+>\ҁ`4QW7YtRPYp@e'ts_ ->(;f`xL5C_F@IjאYY3R ƪ`+7)\hQ+G.>&@(70f/f? 䒑K8xܙ.>=Kf y+y<.k.f*mkɿX)WyT:eŨŏDűi/ 9^ tWT/BWt}x84C18nY;( xQ|?Bz;UK-\Ip63GЩ=|l\, \ i0f``^6v|32S%>NEe  1BH9%*%a?/4H/B GtHHQ }FZ EA}!} C}py`7DM /E WFb ϙ!"#H 9 UPJ[!AE\Q*fKrHR.%HI4 7b5pIIMS!b A@I-ZX MP-@HrH2Q KQPUPJHuc JEDP!uJM5i5RN-VR6(Q޽adY%*@&N?GWx,uޟKAhPmQ-NL\XWj}8F}]3o9xCPQ7Q/>e}} jv0CQ0-?ljua5D9Ч%F L8b 2:O|P37t;FxO`L saDueN ډ8cl ltsk"^PFN,uVxf=%};7# LB. rpX#1̕ 1$9,*yCӽQΉ(Y1$jQZS7pRr8ȥOI(edm!,n$:nii 46;tM@ԶO^pQPRwRxRk҂+_Bj'qhaK{JZU @ݭ[S?w"ۛaSPQ$\y3R]QӻrHPM: ED1 ;wKTt HF,_2ܺBۡEXJxC/_W~4W4uZ]cjYʴ*=hF []-7q / Thubjp( ơoi1d,pNStc kt[ov6]nA6d{R $4/X3) NxuW!?GXS9Q; ]BF.D<[ ))6"MOȫA[%u0y@V#O BND}TNQw ]\\TY#2d=(]8Kqi  0%V3t'R(w$/! )V׈#9 BVHU]c RPJhN`oxH+߄_h40S>œH9$OWVG, LYMA^g͈^88] VJAVq\ZdX.Q5F!gwЇ|DX_&KLUY?^,55!@j@H%<Q3K9Ytdb<(5ή-_unYp@j NOXo^B*38Nu—.}EVQ/ֱ4+pPFuxP q aW@ \р#q!F'zcI4L!ATBW\` PD\~,Sd p;4FoPX!$ ́4 Cq@N{tPx5JTs08߽aDVHxRjkx%=9X(p(uAPƄ{p4Sq͗1E|?E@6;uoQ)*Sjf"Z2ƌ'q^Cuhm)aL!|>>IU‏?i‹xw$&}m@$38Ѓ" t\!p`,Cryb4 9%c+, ,,cf֞8 PXA%dFI8`fC 5G5,ȁd9GF$9J뉭 efrŀ![+oj 0«4A1 xWuA(zd~ Wx^7xd*ey?X&t4v54N0$ziǣEM6F4C\%)NTYPH06W0AxPjGQBR_Dp *'[UeI~!g'YO d؄yV f4f#uȼ۪^st"hs:v?eRK4z;ts4À0K1ǧ(ELjnq!?HG_&q0|]6VC u%%>  ѼaUpB6q% [mu9t}e61ckwD gPvg#'"X,j},]my婕#)z=@Fo\PbjS/TiA'z_4(%'Ps/I| 'S]t)@jLJ#ͫd$j#h <L@ :wpX+䙔]ɐ Ld@*]'5Ãx 4A@d(xİ% /0H8HDC1/` sA x7RdpQcU+FiX)S)B)H{ Yzv_7 6^[6aE=H@z< 76`פzf6 d]N (lP  9 ܸW{!k2HG0m;>⸪sٹ}8ԂtjXW|KteH^uV SuݾLE'فξuWˬ^Bbs;< 8tN~S \AC{]7ieaS7jXQ%!3a K2+UA'#^;tWQSRP_b[uW:YX8z?nb0i 60$/Q(4:RnI #xH^(<'GٯwQL ZAWЛO B Nٙ9 NW19ę8':'d`d©E?`aRSKiRPg{f7WyrdL8;&[NP`]{[ʃ;8=>tESԀXo v8PaD#TkjՉvOC; t Bcpsbsp(W a{K War7; S NDB4:67@C|C]\‹I1:ƒ?PkD dHdZDA I/URЋ}AQ$a{N{X.# a 9"20tVC.#{^ #SHZl$Tni 4VLw"O2F"3u#GC {vy(J=<l( 8HjuCw>rHG mщd! Ll=o%'XH#8{Hl}Y3Z^H3H -bFX SCPWA~Yui0.:RR'f;E>6()ʆ*pFCu2ax馭$*(6B)턒,2P(!+ :P0d(f6Z $P  wAy%mtBe0p`Gއ5 <̖!܄` i;GjjxXS;8QeBލ?f X=[fF`(׀ZM#o '$^TSVG <g2 =VKM~, y4M}u{}Q %ꁟG2R ߷h@@b#tQb!>\q5>+770&  yN5ҋrS0&g09!A}f_\W2qWpx&j&)i ӖRNP cKWN3#%wX!W/[TOS(ԋXȋ;tC ϋ?9m|qY;u[AJ  'HB1i"Z/0w=ˋ:M2}-2Б# 9Г,90AR2oPO, gJor2ɑd x%&'53q]h-[>"!`X|HhkGW}{ĉB 0-RWg@R6 Lɑ@rȻ 䂨 7 9U' Вl^$W!9B5]i!5\Вͧd*HdX@;A*2\,`wJz(SV iV3]7 y(PK?NpPV8\ Ÿk1ЋM_7AgsQ$Y s ! 0VJƁp$Ɏ Wo5ԚBgVYBBK >uWI!0f:^j3 KxB7loF0tG3XZQ8ۀVg36PiC8f $K`B;s{fwWxBϖ >k R}šJ}8j x,JCoj#}(laIBt ^9M (%ٚi~Xz,Rj0R(+$.^l,@Pd{Cok)@e,A`С! YfY𾣦/K? tሡ~a ᨀT]չYQ~5&aɖbR dK'Cq+ d65%d [gh`_D[jx)5~01 :ߞJ;Zh]?QkX2v0IȘj`/0hT(xpal)9Xi|牽0k5˨>/mPZ ?R)lڷS PB̻H71p{W9A-Yq ;ܔBrm c%u 8N <͠n wT鸕qwu5Y>0QjA҇-2`̦{qWE@$u@+SXmdѤ  'fk^rJ@ u<or_.W%xv\ aY_5°X[laؘ pKʋOɟ~G+Iuaj,\5U1H-FeaxN_BHFW=ܤ?6hfOOf $.Xu Q t8{_;^t蒎5PwJxs)ŀ>9ƒ[#9u브Kws%48@/ .+O09D`L=K~C<&T=dDNm_da1]  ; U. ;V „ҴB2?=݃BB x׆}@N!< Je 0|`lpS0 7쪥lH E سM\]\N5ቐ=׵0b\PVjXEu$HZ,Wi.A}S B!$տR t#;H !F1 rL&9ȧi%j u. :w  TQi[Hs&+ mV[r2áPВlm9Jm GlP;wtS{a8u[W\ XQs0j s9->Q-~c#>69q Ij|7 1u| Лt炆j,w3 ZF[L{Mq/DPQkبK%:I $ypDP`!Ktu2;O=QDU% × E PC?W9F_ }SW-E« _3KL쑚WSS[}m5U{R"H,0M?]EF E-M)RSP(CXKa j 2bFȄ~!";!12 [/+~ %nZ4-%랋?| WOh!2\rC T|T -+pt0R YtBOfzP kGg9),Y s(]Ak^4+{FD% D< J5[A +GtN1bqgwN Uo(PJrxOn/,rNCuROw`$GP69776pNyA|f^d6:(*qw0;H(O(W#y7t;@AeE_:wcuHѢo% :}VsuHNf:CT-ќR~HGh΂K:U)?, +vw 1`S9>x>> y_u= Ղ f}{C|WJk |S1pA7[ r'u,Щugާ@=^fp[ `A =Qs+"k71qdig v7\'C }WO$G9 R vdQ&3 _DJbaeR֒L#  9Er kK08;T<Й7S]~Hj`@ÜH@aUӍP##<}$ p+7k|i+ /tVnM>8c^#v$"_#8ޑKSSG6\; Kt_E j@O<~CQuPYjȞukP:$+ WEß Kk=ss@ ƒAV8,kZC- B#YWۭ`,"bċ8M:J?_ӈC9{8\{~FMۈWq|KC*C+wn_<~ۉ9'B;|2 L1FϟNWQN  @ W_|>q_Ui&)Y3^# ѪX&f=A4PdQuVJ :uu/#~u(\7j^VzIAA]3p;xo"VƝ$:\}Māhv O;Wqf;M8tFFSPU!P;p0+t@Rی Dt_18E0]gRHaF9`v+Q@&4,lY 04hba,R,@We"G@(~ [zaN!^x+z^pB1Fh($ A5NpG x_} !C1 ,{O(i1Sp+!l)'4C8Sx_A'@jp8Q ؞u Bxp{I Q/WTFP1u̾܎ k} tr$n n|6nF* #Sf?8 I$ f?/90mᄅKNH ;N0_$w/4t@ܙEܕʾ~G)E̛첬nC=nVQ@h@N3ݴQ?]!7 Ǽ'F mD>o,WQAo.:^{h|~ )OuVPG)(;ω@n0\~:AKN0X^xKHs8o'::8t!g~ n׃~߭DxILse2[7 RTlNG` = a"l졡j[+; ·F<VT R.E ^YtIPH$/łٴu0^Wq%uW> SE9^tu#h. R0B'| r a΅Nl JE"jo}ZyMei\L W'#KN{2bqSt-Ez<|Q( j O#hW'[NY(L' q0u̎8|2]kЄK8Gce et7뺋#ku {Oۛu녙tWVlzĩ&`0bs ":-;P@IH$>X76aw8z[Ak`*,HQ! jG0玵V L/"SH~ !M_6廰N™x}uB9trIub#U\qFVFQ8Yy9x9 $]/ OWҺ _G5W/`E{dxBw #Q"CP $PM윧?UiF_=mz+_-(\+\ ;8g!dSh!uw7r@lw )V=ثɣ!uKP8pR} i93x +x| q)$}$/I+]ga :[qG#QEr0<阜Tsw!n{٭)vķ2 OLg'O  RY\Gf>%~h .|~~|tz5 }*f8xHEISQ(p~F4DxutFyR{Sp' ]L?Ua"5 CC1\ _0UX=9C'I=~u2&,P \@'n" ^A^A>N,䍈adr74~GY! YgSMu aU(_q7FPfF4nwcuC рcz-*_""!ݿ `ۄ0V\b3]Tdz$9O0 4#Ж ¥YpT< Po,mmzVPO< Jz"5DE[ ׽p .(ԆԮ7N 0i00DNK܀N!0 Mp;[ tݴ" h*xt_N2*/#5pJ  b+p-WPÅJ~b-9؅0.zر1 ugqډFp5#x^|}wg0 t4/9VuOP j!aO"8 >WX# )=0!":x<䮥 Q-XP[Gsr(ፓɄL;kۥ}Y1^F +p'1(l2$̓;WB% 99pen60 R)zK]C#qG(jOܢ O։GؘXutf=UIo6+^; [ d&]P_PS;c Ept2]: h% q1Q| p&ߒ)}3#j=; etB$S9Q)ᘤٶ / ݖ߃JP'*%\r* $9L $Ϭ-S ,9XX]]ˀ&|NO!B(uו樔]*%wU @* j1}SfWXQtQEAVS\,`{_8D`[';Q~]d-V JH{&KXz4&#= J<^MLar&f~=Lj%uh1K3ezCY8ubb z[y1=' ~ W~%E aEa aE",EV+kt*9j=_)SS SEAQEUtFEf- f2Ȱ٬M m473ה#fP F@y)&N2LC:kALqx `B9V'fc= :fC t+81BAuVM~%`<$'! C=oŊL #d`0'萇9+'7ez ܍GT;3"CLuGMii;E]]wD+70<;N<@5зqUN+)&)(D^X{ 1)4l5qV|5A=]!dT=5,p+<3C+X!O}ujHMt=1f$nI  LA0DBKA| F\a tC+2P!aE P`|Z0&Vu#X4T- KEL%=}KXd@^vs_ H.x& 7oC;3F QZMQN/ 8-G'~C@AoA u fy=_SSXI e鼾z8O: hcFh^ ?4g``f Ғ,!YKjEw4b>7PxØ =8`^NLP[X`tU8(Wkdʳ>{bHV7D!=`BU >V!n` s#m!gFu jw^ʸ~Y]8SA,#yw 0VF/^tX*KK)9@jD⪈I &$ mGL7w?n I se=#!]%uWt;QC }L3+}S X) Ɉt{p.4Mم@œ3E R;! >#H  6R-ku4Ac42KرPA44:M.ou/Hes4RSPW.TL'c_+ @4K8#9Q믝*d N qF(-  s p;N^Op;A(0S;t&CV ҞWJE,!mj6til #觐9`KHvMFue|<<˜D6I=τAt"Za/eܔ MA\av ÇG0<+dupLp]gwZjCo!J`ZX7iQwk403;^ 돵gd訥 kNHEi6A.@9#_q+F#RoY$}OZ@,/T VSPNxNqЊp"<EG_4Ut f:^PC+k"!qK1"]!K.@X<#SPx\^8su$ ?;w=~9)RCrRRpZ\Qad1ɊWB1wgXEPY?^i-&11F+년m4]]_ %z=t .˲, j0jI{K9W&­VI0+7+–pCusH#"zJ7q-b Q*dd!{+whl`Wv&Eπ$8Hzh L4L#Y$Ebn*K|(  8H A$)u쉳4G%ȿ HX52YަI}W`v?PdXed*@P/^WHj)G6@7;2<4at& Tua}LLY 5GxN+B4C(`C^]S c@b`~w@ ˚oq}S;0&lqMǠ C˘n~w@9oa;C;C&&UnXuYV9hUa%sxĒ?UZ -!iY)p]IxDp++ `qOI7w%D߂CnVpkF+ nWUYw87q)zND;Q5@WޮbBڍ<Bߤ8A<"ck$N$z$ 2x}t@$ψh3\/@~8M!qAP7ICHPACu{V yCm:I5^5YBKO ʃ6SQ` ([V%`?)G@w0@*;c}*2aQ "&3` 0=]0 e)8GQEϮOx ɸaSkCHS +v\ n +p7,V+n@HH.0:*o0rɝLtMo6F"K1c K0UaVU"jRUaU9F!OU ?L k c422:2KWQHܝj3sUh{-R(+#:XJDHsO<}ؘMQ>N&BQF+>/90mO("mK08Z2=i&`"];w౺Jf8`PmI}d^2J PAå3t 9b}x4eLcE2R # >_(19)S^X M& 6Xaa~^!UL{u pHWQJ55@zpA~#t%h0nC!eK\&k:(X)·@p(mG$QyÛ 3vC i(?O(.VL0t[j@z ;jb,اFQHL:ڗpR/*YBW4}TzLgɌX'aCN08}m@|Z)!#=0q-ySF[XSCHlt^ZK{@DHI/4p]S3EA!]wďB3 ߆,<!ZaD &K@&YҀzX$pA /:t p0"I7*E^|S`|p5(oim2 e< QBH{02i" < G˳uGP@Ԑ$-H!Tяy_({F$\(Pz:Q Qe*+,ls~@#FwM3d C 7\ P+6;~; W5N1B4ql+>||Kh ek}( I$SP'L.9~ +jC!YtJnD/ܯ>`L . r`֢D?fIp F-rt2{n 0 \Y]_QȖ26IE_6cL%<%6^o8|g7pM2<У{X̻dW}R+cfu/tw#v m'/081Wuځ .Vr- оjIeF@ՠ-fNZCN7Z857v@9,% l P57 ) b8^QuYHS3;FH(~FP# P\9|'DW@r}@#NFDP@ZaT0&q17}Aa t.P0L;Q ،c/dd,$E{Œ0p}0[@!00v(sqnWY`ø*/I!_QJ R,Ua!%V`)|5(|%84`Aaסr ψD݁~t R+"$_4x!}[p}©!!{ U & i65pX(]xs9Q!7B2qX1OC막¢SPw ñ`  g=S g fg6J+30JQDa++;XV5+n*?x)PS;-nL-9tۥk?8@9g;F%GΉ;UFѭ0klL5N8%7o sr #J+  +ׁOV:9h;uf8m'(0U *Sd98jCK7D/+>gOxea8Z j+ϷYx ֆ]ګ"+؋7x-9u`w +U %DԆպq3ߒA+~ } gB;| 7Fz$a!.=rY8=&= OB&ޠCZHMB:e @Ͱq#k& LU  _XM ;BE5K;B5b˒i=_l!9w* KɑIE )I}Ē>jdAAE_%,t18\J7u8GPPS'XggfOW %ߧYejIwZZ'Yw 6 H Rb00 %\T r6{x!/v 4o^nkp&]tB6+) 2:0&xA+;Sh@r&+ Xs 38xc WaJ ZxwNKC!'NTNrvNeP|HlhfyDA`gK oمVwR:m,p"VD ?hHPVh^WVKVܒ)&;LUKgR  4d딍[f]Lz%xޕ:{hzBBeBG]Ǹ 赢}uhv(k G }KI 9xs@H;e ϜruxԖd"l9~POx:F{K89 ]0d}Y2,!#oǑH+*I(j$pa  J0K( a;zVP+\Qj"4x%cS><3CE$jB&WR,B$ ޤm+- Dpe5] "QC& ji'Ssn苣׵u~R Lعk8` J1%n\[},Py\TbtP3[HOH80}MvR+ %L/<ֈ[SPڅR\uѴ9p {ҷYKCLX4)נ#85 DŽdC9H ]1 OyU3[<(3F h lD؉#'@xntL;Q;K5^uD=!@+^LSPVW3/@υFvt 1rN'Ĭۣ(DuSUw>CH6Nދh𸂇Q n5pJyS^P3ON4nj !Rh?PxV!.tyD?:k؍l"/ek5`IHY;M=2Q&V^tN : 8j|&[h$!'PKN5V.W SxiQ[p$X< V-̄rqJyEh-R@FެM pl+)hVou\ 5=JS { Bw)U (CÈBdQ셐&,BXxu}āH\ӎSzSP 3'BPoNMFL;`YE[!uYMd,Yxu0]4ǁ,"=X<aS#"dJ!lP0@0[ &cU]V Yߤ7qy 3b9*.E9494d3+\҄5k011mw0'q-]OLxa 0ȑWA6=7Ѓ,yWlP6"k(Od,FW3nfTXMILvA2-@<1c ~ .Rb9v.'5heh08p}n'dt]IWtJIZLr5-h+ݒUԘd:;,O1J<Jo=:ȁj{7{8 EC.-i8sh i rhPI0!I[!6S |2a&C-olsՓNB8fH>C:a Pa%RыXqqi {!#O[cpK.b?@2<`AL?ϭ2p:#~T1hi }  *JƋTkYL?OW(FGa dHCB&? #բ@zxKG9EJԑy QGE93 V7_+{{%,25m#ʏ-i y "yB!T! [2:݅qa ĥo880AxOj opynP;ƀ9  [XwSXa7I44Y383Xn/c3t IPU 渭fp* @ KV>1Q5SGdOH`l`r,)XA1!x RSj)+hmVkj1⽍nKhMÍv'Qt ^c`Ul~rX|?|Ía9;1_`u%̖G[duhu 3GlYpu!}ȇ|tuxu |tYK.Qlt0RHQ-mP@tD<ӎXY ( 8K0/I (]ËuyrFzTnD0+2 .P&WCDžlN`[C=ܑ1dI|j/ SG3I\'k6$=#Wh\pQ{b]F.}pKYQD %NσcirSM\e`Be^ h}Lp8 eVN._i}RSԸBÞ b%+:q@؎;tL i*}:ЄT\ < w`h @//}Z^&aY9LD rK. rcHHs$C (%v (_B1ƉKX}gƊt_ `i׮W3rCj;$Q2\r}7CP!?f+iWkKU[>ZѢ @PI2I.pW4fH[$s}vW6ldAg [aє ƨ1tJ))7]°aUx#vg{. ̯v! :c[6 dӰځJ(dG=88'? Hw8\OSSWBJ^"05东X}Q9_tc-)XS {mD`ZV:Z3`\}HL} Ip y^A8I>,Mub䥈EV!YPSPN a$B[F@|BRGt 3f+Ϭj y #xB[նpA ;Ex_&P];: bXw>p ^ʢaq`A X:d-to'ċ0Y3 !:6p`]ݷHULq`đM {!Lw9OR,#29)B[9: r"v/@  䓆p"p$Δ$B؊EĢ?X̐ w{¹T@񱇽EELg[Ha},7Ln8Ћԙ!!H w^Կp 3[-$̹ F̩ 8Ga j=(t h 0'`P*g %䏂x$9Hf9`X1Hް"b!pa[vQ;[Xy`:ȁA†kGSŐ-HB[Ȓ>܆ #@." L!SHkU]DOF"?Eea'LyH@qk⚀ `@15S, ]93"r,4(("3 9&t M[J .5~@Wϋmc)hVW\4XH|FRFQXXD/cV5 e _w욧av3l?Nj?b>D>7ʎ0M,1w9}y^"ЛҨIOބ!տ, =%@8&O,B TUN0aИp l TeƎ?l[M>> @;ᦝk?;a yr8K< { yQ3.Dh\*}Wj:&6} u+ YGęR Ă$KeAȲKvaŐ6(d ᴤPx5* ւO" LP+Wa%r78d*TbbRؠ-7ux-3Գ3Ȧ YQE)fBCHėV+.rPbN h<]3'4a5_$ JQ1FImZq&%pPWb@tتcXfr۫՞DHS xJPJZXÍX$H2p*SVЭ=uQ駥QY] JD}WWjW'F]HA BC5XGe`GG&E#n ,jaHo7 TDk a5h+p`K1XeV@VSH JT)SZzuqp<NDo+SWG!A)vZ9 2$?*[`NE(PSX;ut7#"CPCUFsNٱ;ݶV2i##21(^rѥ9ht4mzl6e2JX`/ȹ (p 82dxj.=ѩRw)`!Q= @A1HNIM4^5ar Dpxem)ু;m&&V<]B+=Dn+MHOT?6+;sioA {CH"4ۑvt]c{Pk]d\s©`vQHAi6a!f>;s/xHPs"fOTEíuYj㣠8E=,;ρV9C…SCXI21"z(FG& 8=: ~P%*?jWVj,b3}\ɘ Vb xH8p+|t)YH`ce'GJB,K(DzpY#iPs/Aָ|^{WAXuK'nth*Gt[غ +p7QKV%@GbJiB, ^ 4z̡@ Ht&bysaH[,' k6CJ A3Y5MyXL{\"0SC&4.[ !^ۆn_E3wHo=QXkKMt@/3(hQco_R&[ftrRYrOci!oM:'S%ᢠd8d@˘yP2f #gٷ;CvjY:_;s^+9M#Wп~+UʋSzѹBW3RZ6t3 kt"+Y0͍~sn++TC'@t`9$&[^pe0%H #BGuI 6}|H6K:b!EAft}1x Ll1\x! N>J~,U] /@$SD:,_{82Z߻}nt2# t t;$s ^Ó|ǹEtv>u 5e]8-X.M'pPn!FّlO +pZn M`5s U&FJ<_'9+_T À (yy+Ƙ 1¸l=i?!,)O-.It:t.DB      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~c[ڐS!WmJh]jNj90< G$d (p˲(,,)099,  ]fȋ2'!pc5p:6?n!a t&.$2; #{RKV, $&jV_FҿeiPH:㴃ZR鲠nֆTP*Yd?+vLPo7p) jDYN MJ=*o Y7(b7=1U 27? ‡Gn?v 3ϼ]..DIu+ 9Fk@Fa+! Sxp;*sA VoCۍGi1 HLñ\ Cs1wBzoE(#+âv= s6*opGA]i+< 7\ #39_8Bb?)tDŽ $:7W?SZ(_wρ;8;LMa(Q/X֎‰u* & 8\ P V AEyڙ}5PO a$ gJ䑓ա79d媻 {USsL>ʫHl8&5BXi3q%{f×>"̥"1! |H}{+-9}X+x}䙋TB' 2\ɇC .R+.'b`D"Y&Np":j+m p'L!$$B*9AB,,P(m GNrLX q|It@[L^@ra0H$hj 9t bT 10 )F^"8p@W+lxZ|H:'$qm@ S^tVTI$ F'2 #L!J@#4$=#%;0#$q\X% { %FX$Qw%­@GE"[ѽd#`z1e/jL>4JYzuN]fDŽZ$?^U蚓@n4Ws H8.xS{_V V7Co8DM4S]oG$_@f-:fBq]@w@U QBVIGd00wr! : "cYal(Hv"\JTj,197Y؈g SUb1r%_ІDJ[da ;}! "C sK AfR C@drDk!AR*d%#h ķ$3+quf͗ϿHztu09]ؐiK|ϗF[݀Dne?D' t0[<ذ$ 1RG;8dd4J` 9J4 44Q44ۘ444'4+mQ4@ _^ YBX; !@+!WE%W[$W(da$WU`$S4 SoE5Q& :X \!_@ޝ4ѪlbDW 3k)Wh%Ҋ$zv;[wKo7%KI]q4xAzDZl/!+ S 8.Xk JB8''H!HaڧExxNX/=^bՀHT:ǘD`{RM ~I{`ǵ0Be9W480zN0QGJ́,#\/`6[Jxd"@x K&x9$  tf^^/#  Rl4P ķ3>9f2,$pF$ඁ LX\e[3B<%9 _[d#Tj|yX\^`3M ፎ' ';y O Hsj hN ZK,' O .TNfO|99ɤO<ہD'Of^vl'ZKISAȼދ`  l6/;8kSPMH2220 123ݯ3245XV`ޠ عX`.!\3v0A'Od䁜4'.#\N7Lto+p9 St?(#G _8 VӋG(F 6Sx!!؟0@Df3] @`" ,3EG;t;6HrhPQZ\OY<_0a Xe=RcX K%+Hvq~ .<"qO»z !8q  Hh  #Hd)@H+a#@K   c1 /E!u (% ! Dي!N ! 9@x ٘ !POB.  P7!] p#'ϔor2 dS Q!4#85i!3q:vPח!K!|H m}{QG!"`%E"%y"4%ZjE%K%p  {dd r WB 89W P߽I 7<8Gk"4짬Ec1 lKmQD"(ӐayY2SG;VS҅T!SQj1O0uSP^SH}-WVtmƿWeLa }?kjR,} 6TzP+P:DQD+`՜ Fh NPuDO4'O9dpJ:tTB0fX3,]} V-i y ]"[:E@MB;I pHLIuCWSB-[FmiPB&o}Ƞ 96HO\"P 5WP Hhe> U+G`aVWϸ 8tYcL Xj; _ҡ!lcXy`+(.b,Y{xȾ&Op&#]Rh% Y >G0RC1aO7g8G\y4mPf/ܡ$KQd,wgRӾ/(w67ޥM sC3ԠD6HCJ|=Wum{Ζ @2MД$& )7)w@3IQnC`*!2#& u ȄiĀL<^ =sM@g/m~Po4QtvUV[_Sb Ddjfw44$W3+5t a+ cc!G7{7t >B| C88r8;mL D񎤉aH Ls (LL5mU,Ma+5/*,NdaDHdRKFvvW}F}:m-f fX!.kL Qq$RpzQCW F; Ɔ2+m<#hUqMr"L ͐9\~,HN, U1r9+, Ao+SD<Tn1QS"v -ubR2`gm (-`FnBg(eݠ7-tGbth*|fs 3-C: EQ҂Q3d"lb` %[P#qɔ6-!'y--ǃ-+"`uH @؋1;CuPl ?TwE~v:$rBEJ.LO2ӘQ瀜H #J(Y/[Ru>_eu}Eg S3< ܇weE-K<=`!;k9sT^Ыaw57׍ ;΍AQuL[x]B 7J$ lt~e+XDh1'9FTt, 9u ̶H54p0;I #=aLL`eRX9A[\&'J:\+svVh 2I{DY)TL^G{TH i [QKWU3q:zÃ/&å;ซt N$Y≏'̀3x 9dK&nQ7EWUV_sdG(O,!|Ȧ;mwM3T 7'9, [1,!l"rg|"QI<H.96KM]+شd,2 c̽!<-ܬÉܼX cr j׏JQRv3wE!8a\Ӎ=}P<L{8{ĝ4PjNwe^ jPc4DgD hsҰ`g>NoL)&k[5eonD[nY&Un&`FBcWM&U u czM Wl4G۳J n^ƒbaq7 QHژ=dY~3:`R%!8K DY8xU  QEgd V R"7ĥp8ƋZv5as7 kpxP@0RaAB4xcOl53C60=9nPl;8'w2۵a &X89Y$-<Խ8۫n]ࡵ8b@p\K>,}mnGLDQXp)5Q% .cg Bdoq*/z$>;$_'gW(ҳDž( pvM{wmqBWW`-%` Aß?_t`R.R i 0WE,".:/ v@Cr$8`x$##M&Nr`S6ڱS 8iKig-`s'0Ciūu6ඩȡ X`H mi(`A+@Av(`x)pH`UJ``R2A22 @2 ŕ G/BÚII%sh@s!P sdV`}JGJD@ a X gXa`]!2K[ZHţ[DG[!π ,>r,L7@,Bڊ[l Z,J &E PԦcj 6.}*V#hR}R0|ZWTmƂ EX S)د: F4AQ HD%Z/r'`sXQ A S\BǵvK[H=Cx܋]=xyGJ} N=H"B=$HRH=E7JG B\7Tr7ҁTqr`D92oAɊCH@iDϴp tLZD.<;g;AFU[HM/Y6vBFQ ܠ-01& z)* T?8{`s_ &Pf,@o'hO K/ f>sT&Cuytu#%A}N x#K; <硲QP9 uIQ$ƃ <ԤSwK`hHX¬?1 U!6#L.YW Ԑx7I@*aJ}'?@&*a@}@\{l=L <%l'EJ䜘 ٕDkȻP|BT+``H=TWԲ:Td_ i'+V%8d '}AޠM & %W IW\9'Z AuB;ؘlt (3oDa #J)HȄAD&l;j O #Ö mFD0d2ad\!Ʉ3 !X5W^T tY.rܰVwAp\quMUN"ͥ>dav S0T̀nXc`wf#'tg;[nhtTOZM 27/'`x[PC#[$,#M2u9ɓ'd5b٫WȂ=C$,\dp%`.ʩY4,Cpw*rB&$O}LƠ3Aubi+Ɠ]&1IG &ռЭѶ@>&7C3 l81< OG9=[XøYjB*!3 ۦOS1"B {5wlH q `4oq pV0tuYxh]Э>M_QV\UG\_ ċ -VM15_D3uQKYuٔqCQ3pc_H R4 1ΖST%`ҹtN(P>xxپ2>3cY%Vt?Ec5$JD!z)XcHtW |I2m@}؉ZI'WتNP%(wPXi`=(;icIU,S̏']od b}KqQD(0xW| 8k5KU# E1+hxoaP4w=@>8V w`(uNWWPNPHpOSZ9HP_g 5nX0_R{p42Jicݽ6y>YeeE)2it20J1"n$Fj\X PAyn "{dP):d04HC-JIKIS@4V]RVǦ RtR>7YW者vtuԦ'Hf 2)*̸8F]&% ~u!\uj Ndmy^l"!6|Hi} {@&@$u"[^H2Mn!OK 1 P qqdTUdUyq<Í#/ ݒd/$ x.!W!dd($ Dx:*$pqnDH`!5FōB,q K8cQMn5qKBw dddh*hd )#@.JfEr IEWW& # }/Y"*{KDdvM`N9/'BEZN9Ep3afT2 K];nRs /UشkqndQ=,[]{{GBER\Uv˕O 6W%gH$?.kH,6ŧX]2PTMp -MNNI)W0'SXCs2ocKxHĭ"EAlE550aQi* |g 6Tp4+4lO4S!Dopȃp43%444f4QE4794dҌL444f7a{{543a3qEFpD44!mh/|H6}{܉ZBb24894&9 p ] OdrP4q=@m"yS(((|L 8KI((:0cTy&,Zy({*,(D yr (& (y &6}ۛ-}(õ KPwbw``#(BIם,S mV'SxB<`M݂&*;` pONoAp,_8&%Uj.|+"@*{39>·qT' T}IB`ň֚_h _#A\V^;AXWuFu=2rDwQ2 ;!tQcBݸ"BXCd|R*2  &㊯"!OyN0}Ll4Waf~nX5ID1e),`s0# 0 0o^n "G#!Tc[/ &F O/Iׄ\ZR(Lު0MHEÞ 1AM&Hl764;MGdipAQ`p0$}评lR)޷H`+ P*<04 l@Af]YBjkZ`h80N ש{"B4oBи$_A RJV.ᆏ0HyhWnWa*P,C`a$DMJά%BeH@4qt j$9H@\?HW2@>@@Q@A@ %lvY@Ě%@*m2w@qx%*4 IBe UY#ASut)qGtc=WYXA="|tU,{@;Q]CPP 5FUcdp D *@ 69ˍLG6Nu&V=F&FrPx&=+ 9&,x$4tJQy9N)ڋx@'A X@_kf&&TWo,Ɂ o lVo0C~t^$+@ BBpNI⣉C@hb9?%ό2\FhS ! 1 Gd/8PBQ L^ϛBH@=fC#% ^ ]aaUBᓡלF|Hxx'CEtA^ lBXWjǪ:P1Vfo؁?P& SP(հk H:6^`X9H;۞@,AhdB^άb*),KO3 Yg?GCK#6t-QvXkl" ̺, @5!FmBZ2T3v!Lo>$u S1#INHsK9 1. R$qHPS&Y/ [* E~ZNC(x!m֠d"x JuUA :njdM͌GS2I~ ~q SMOr]cAZc_!Xp rƒ[\RSGD3XܻYC nN!,)LaĈ~tWp~ xPXL O(|RCfY8kjۥQ^2ԉष0Q8 =0ણ/Y rGd'4Q˽+Muά(JIDD#r +D"yd܎)=@/;V^[XTǽXlÍd}m b]wiMѮ W֯{f|lg3"9-#n@^I%IMXKGfPiT3s+`UV5p 7r0d [5vAU ӆW}3V.O8B% 0ebD'/u}I)2YZH)Z!4đ,2X£tgJtUSs=ݷ;Zb$ZXyKh B:QKd_Ryiw  ᆿ|ltxU+7>P_MzsM Xw@ SQGy'8cfe3! 9%8mz`F8 @&.l@ <>Y _+ !rs) ey;.~zqLi#NL_xH'$%PV89>eJXU"͛]mO9uc1Hu2ܒX0)X* DT!B[ S70}K}j^_FaJRC xGܴ\f$XnX$@-u^i/hA]aP鱤)Sj$Ni2 Aw (j, SS;plA_Rh0D*;ˎStg7uຮ-eBzWy$jN$@$$S'MMA3 Xł^AiSȁb.zI$P/t=%+6mEvj\}! trP4eFpye4Ȍ^Ȼ=>/0 l(.PYSZNĊ),ܙ m mj uSY{(w3Oj}%wqvOj({2E1u_r-HZ{#3r0Ćo_B` D` |[YylnxḬn,-Gx֝ Gm } vLrPˇA¯(Kr(oR$ 0JW𣵩)O~  i}IPw³z03@|,~Gun퐄/=ѐ.Ewt-@~Vf)XĿlf .(i%'״2̅uJX $/[N8~^p/\~ WCT$ ?F`)}HK>Ž% R]隁~Dv"C d7GZ bS{Fp9^uM |?quH%j|hTM<"?7h%ӡW\]\a/005ox:d:,)x@uVϑlLˍ9c Vd.dKmN/ғEI+?.3Mq& t }N|9r`=e#\uSMO0ª On1QJXfB1U@]WJ %xn@L)A#1[K0 7_+x0w$#G>%TQQp(kC#t P#Jw>֖ Ӝa`hD&ܹ J5ZsV 땼: ܑV%z 0U%э:#oN>ޅ5J_Wt .Ri9-K^bm;@*. ~a |X#2jl2222tp*. 8Aޝ$G. Qְ5 q;>( =hcIJ gŅPdO]#Fz>tp>iѕP(}H,Ӓi@FA|k 8wPLPkMǍRۂl;Kh)7I}v څzh $:*Bm7PMvc44]SpJefj! 6R㈱+WPbk6;#ax8];,"ud^йTiP:j@DQq#C6#82S3bU.=LcDcQQ{ rQ+cL`, "dTӞw*4L L@ ciCꞷvۂ#K QM =Sw0~]p/H(![奃d}mѩppl 0@@oǏ`<-v^^ͧ7jRh )ph3 t}EaC%dy CEwUH(ru,3=WP9 9lm-7VuA bA uw/[ k0rbEy! pa*M0P vjÅ $ ͻ>-f Ab]Vc(FY4" ̉C83 < @zDj Y#)╏@jZ\ 6 IDD!8AI@DRf@Dvd_A<@AD 餋 gA}P*#A!q/^YH1~,[ơ$ MܣZ|!"۲B ${FX_x>Y!F!jA! 9tP @`XXo >D^ al|0 nn޶ǯA% -h'  }OYK0mڗ ][9D\CZ~t t #FS>-ý?aFYETW 0| 9ʃ0mA|F \u-<7afWt 렄[t!hy;&';G,aϨбP_XpT9S~Az;KhE!ɨ`a Yw&?[NdpCUF4Jvݡ(=Hy@eX;u OlS#gf9 9G@}ċKf?%+-H(hl+u+)!MK0[ x0s5 Ɂ=SCPpaHT[|L+Ɗ]uRIw;rEmC:e787t^H;rAh5pAC_H -@g%ÉiՍ<HlN=G5emYeTVYSSQ@VPR9e| TS08B${ ?0:gX~x-Y0l1 X|(=4H dRBw=>fpB0+D6sƊ=SL!YF[8i_@Z_-V:| eHHaccucpDns@B30JE1ۇˣ\h.3cu?H>` HR~,'ѽs. !%BQR.u0' HF H6[ClF=a45]Tp ={yyMIM H-UY f#>^V&_ ֵ i^ ynPu1'?$2r!xxwݡdWXs 琪:`MF6!GXRQFSCmueI;q'X *?H33oA 38$:3[e 9mC%JO%Fu2{1 f$) M0ԳзŋD3pPv}UGSk CdZJYBPHH!b,y Gp:e ڍp'G@q,X-S[갬c{Pvp ñ}+[0SI޽8:f jb@wӠ/#kdJ ;+`w$8Fus@8r 1F|suw7 VF8A>.@/'6@Z- ohT E,EoT(|OSXᆫR 0w[i"wLD Dw, ;@<84P@(Xi0!0@YI-7SKNI>7f#f8M awG878 <<˲,@@DDHHH 3J0ȁ" Pݠx!836FyH-ap~(-Bm~@?,hFa20 2K=T}&_9Yu$ho yXSh2{bgO>;B11T0Qj; F `@.xЉ"VpKClYoX? 'q$V&pW_b$+\$w (턉Vu H(-p X _C3]WLޢz2(\%Ҟ 22222222352H0u'CaBS\jn ?FNG\h= Zc QD@:ÈW݁[!EhhE\1鎄3SƬ0Wd]AZ#}c,G-~ uI$Rzq&%U_+=>DD\m_ꧠ83u[l͞RE~\%x\vgm !~{,y)Ȝ$-.$H 'y?R']3 u81:H@+.5x/&uIĺ=nv#$%aɁ5BRjjq_tr0͔ PI 9B)`6?J̭ku&"|Q%0"$ J >7ԅ`(!Kj3gAKnrN6DQFj'r- N[Nlh FJT-[h4#,QN}S;10u(il^V`uf8] CNԝP^A +I4ĚSX4X랯30h!QiLA0Y.j VWx9psW!Ө䅸.90(7q{1<^pԋ[)FWVL9zEŨ2EC|ŀ䡰4T B!$(01EC@D!u)؟ۅ|(Rj׊;aX$| Ny!ՑENWvaP1ltj Cȁh.E 4녰r EZ@gb6{Y0m _KHIm pnl'=M r2+%Q/x^0T]O41!y$ 5;C6eO[3q:̯!t&U&yF{ j[x#^8ehkoS; udHC"SdU;& Ӵx/-+nK$#EczX > [t;Qt- >C}#.$pBNxG(,QGb!Irò$ x I!,~VGW m@XM,lj([n1W/N3͌\/tN~Ű5, d>g[<4C1! .h,; N0LJPg 8aMz)JÄ7;3$,P;_v+ZH~R֝!_ 5NŐ@Lea ,c% AG0CJ$ 1  fXa(w 5nCS&Dg| " gbB)_cDG)9}= m7tp$ 1VLi(!-- W2Go0D0EF( 73,L lSX;GXu\,, ``5^V5)׵gb Nd8Ųt]qEW{HU |.8tk[)Wˊ|טxD$I1: $tKlΜɌ7lcWJ4cC? x\ɌV%5JC\c?TEF+̔zu?@ʥy,`ml5ݼy֙0ǴR ,*q 3X;PUEFtGLL6& k7elFL5TVШw4w$o_H j !te#*h]:S vI0Ԗ(K( p%S5 Guw&Qqx,QKādtL ui36A` ŷ'1B`X8K1%qM )uRPdXS6MI+%LN"TIDm,7"\LT*Y уWX[B7N1 "y Ly8 L_ * GAz\PTEeg@t!E!t@c2@ c pPjltD0 L)8^0]70Dh]4ƖM- RPk-  7@  sڤRV|7 3PM`*BUEȞdPp j%N_DF(.&u`Vj$.0 /+( HCT00 `DviD0$p}DW28-+c*( ,',<^d R,yUjKh}Sl `Hg.T7BN9h@*䨌)׉dA&fdVX+&  . 4E ,L 8P4P fqoiAi'B EBBTHq >,b xK;d,B.i̩H>@)ۈ* "VC:yZjIgR&AB 8m^MrwLb&xA>f+CբF 5q8=1MD-kG1PsƋZ\SyC~  t80]„SƐCS&ڷr~bmt*~K+ʕghiWyG SxRڒyvS4H%)tHqrL3,yYA!G6-H # XW C X6}SAi mf<* | 90i WLRU(1NqCx52NP *:FnZPԑi?ZL.QZ@ۀ} Wu LC!Azxی#n;Qq"!=8'2a/bE #nIek Hs 3ja2V1!i+E 8_‰`* pJuahY?ډ1&G(!KT  .X402OHp`$6CH%$#%% 6SnR@eSuSBPe SS WD? !"Z1GN :n@:aEd+9!`#at"g$`659p Tp2*o `"wD+tRHLsVQ Veܩ yT`;IyȁniM{Y;gKAis8v^D9x}1L>GjR%ߐvh3<rR 葥`T&$aų6:u*[;s Zq?اS+I`;CFAHkF;r;^@?f l GЭ$=3 $Fhq Y\@AtH^ʳ%\ $O_[R'ZV9NO @QG{BCZ/XqYrȟ< é2t@=C7,tGÒXTRꦭϣYD.='yI=38 &mF*0d0^ϸ܋z08ZCHt xC hLBr뼁@#됍0V$_prb0hNU%E`Ey PAimT+(#,p!<$c M/ WYB`g8}d4KtX.FQ'`$  7NJӭhLG1ĚXY968Dޏ EEJE y!tXD&ࢲFocoVI ۆ6bAX)<)5KF79[R;I p =<4 g< [\vu\7M 9F^L>@/ G 2%ͪ`Ut@2tU %}GmwP'/=`}H!IbyhLG d6q1ɔ7[3"˼܌Щ*dMLVE6A\ąDZH4HV $Ha%>0i&0.!3\ YHࢰ '{W$d@t!C搑ê)qS!J+E*_4RTk3E<__29/y#tАfۧ8'06JNBǰyj'Q7SS!"]d,\ƓBݝoVC'J!bT,a(h.PcI#^ÅE_E}(R޼A 5E j|/0kQu VJy4YCJi"&t>Hi3'H7CcE5x4Gjm-B~A kVLwǗTKo@줓2V8wl,[X Ď"S?vZSD!\D )jL(gMgKyleI6eDI+I*x>BA0R fɏPn_HT+t8H+!_ENO޺ +&AE +Jq83I~Qdž4tKdNt, "CPdRJ>v Ǽ,%^S/i= ;٦V"?x`%_-#=ND3--^pqrtx|oٜƽ`vXy5 %@@p+,6 LVf0"Y_J! ow˅kggYjrCBR1>X&bHnCrR?a,"E)3646 G|  9xc,!\bd 4C%_AFᧅLԱ[ݴ0_'ÉS u!?T&$o1xQ `G˚*gjB;xDF4y8bpd"mt7jd%N ǜ2@'`$@{TU48= m$i ia6p@` i7LA@@[K-%hy d3@g2 Z.$0qXF^Dw(=NS' y) ^fCM)/ .5 /o y($f , 00N g1p2 &&&t6?t[toE~YQPRŵlE(6,d;*y pa$lRݴ@$xopz oY ( ZX :X{X PQVSg$(@h[=%| s % 7/%'@} | lz!`iva53G%G],4 ,9d;V[2-@ﮑ6k[#u>]A%kJ2׾_G@7$  {&Ȱǐf%m8-EzOw?Y@H6-PCp  8 ~aV! 0 JݩGύYQ 2+Wn?oWT_M4Mj}ʴ4X,p4Mh=VNi.MY18LB4iYVZkMGFSMĞw 괄t}UnF%d%v#;f_&kS^JK[_ `]M0.࣠f~qAb<> 6\htaCN7hn@g,KǿR.Ws20ѱὢ($h[! h\5v*d 0jJۃAn 1 @ nBv$aIKC0D@=KBY6;{ȍm,t77vd!s^ }SekM<V `'b K@$✤$ƩB-X uWVWY" 7_}`(Knhp teqbI +WQWHG6^ȫ[yDUBܴ:`?b'-XEhu)Rh9OSpu>CyP M H}BzmzOСD%C%+ PO N {p Bp ϔ nH ᓓi +yd%%mO {5C% 3qgv8%>"C#!%|G`HW}3ek{)$Jݰw48''A SrDXi*,n l1rO~uC<쇪'#qػYH};Â~W!Hп(p@6.܉t|\~=S-…!ƶ5"isROPT$ o[z 489eBMEBc$@> K׉8$pB> BU-TK>C!1UE`օdJ&98 Ȇ  hDy ?+Rx19%*X%͞©c,.  8o4f1H3X.pD դ_cZ#mܭT8ߍi8ZAy]wQ$ŤN1GXYVnpЉ{ Y^4- aYbaqWEa 4c4xc(TKk q+hyeJ=ȻvPņ< G! |r i awP8G^!p.8X0I6  dJVH(#Plj+p0uA,w }90v._ 7d Մ&գ5|,[HƲnADr42f!oU^w W@B"WH TVS28FۡXIWFQP"Lԓǻ6IG#%PS F `7@ Pj MpZ=༪Qrx [ kH_WJdb:j(]Ue23R M(R.KXfsX3],JmS7w@ &A )Z@OF!MfGjp FxO8I9wFF9'gH fS.Pa.CHW j1cl bb*)HLQ򖝖(`xJ vB%#+_S`a@ H G .YV) "q܎JhE>oT+!G.#S/4^!t1Jw PAXKGOZD=tIɂCIRxMNU|reiDSD,sQDSMdDX"RwYp!]6RDt,*m#SDlf`%KhI@<[0 B~\H\oO\ G91A0  \\''ϔ\\\dF\\d2M@ \I3\\5MH \3q  \L\! |HжF}{<_ &\F =aUW٨mHAOKu9;tX%v7I=& +F @v4cd0awBLr`\ɑBry\)`B\*J.U\\p`Q\)\ (Yҁ#N(\G+mFd)\G1pSWm2Ti(U)ZG\{p<9+YZZ N0F_YVL)6FU3?lfYu^5$d *l[\U,(%jDw,U%HqU,!JCG-G3^855D$G7DSHQWD?0[h&/ٙ , 6aa5J~(012CBH_\kKi[L%Mhag 9 H@Ly C)92l99W4u$H-27%U;lH+ 8d0u<3]h C?!0X7(f9D}GyPhhP[e*hh!DxI3BB xH\hO8* $$ Dz€4^hpX<&ctn'SL0`h lHyuMD1D 9})@;RR+|vҖV]&.dn!\'˕:3o{R@C<\UMRk@E %@H@MBG[W=-;!; : /9{|A?E@}"C _H V q ˹9M`X=}gHHD'N .lRcQ{ q"*]L*ѯ< A>Ip,BWj,e&"FXic-B3`NYFB"RA)dcpܸ3 㼄B/Aibd#9$  Gr B r,V ~z<}(K8^@F<A||)g >9SvH=a969a5Bsw" A,M R D^('Iٹ_^_^e6-!)\l*؞ǫK8@/G0rLxW-PB)p*V@քYqG?`Bx TnK t] H z a0F" S˸wvTK6qf-9 VUkH2""hU@w}^ W?CtL逻h0|c%Py`xjAgFWC@4O[YX5򞰀FP.550rl~p 95a35M$r200ęCٖCx,!J 0<_tѻ$ 4\ZWd9D -I01BI/{EoDFoQ LqQVSK;qp أ '0GLy.y:ZFjY)huh_}4^QKWpExK  FiLx5&xt.XCp0;w42մD x !S)ah+h. /~y m䐇@%|h(0\ 5ǘ6L 9I(x;yx쩔Vg! 2\\MaWar9f$ȃFڣ W﵀/*u8u>,ݳ :* 0qJ|fF+l"Ïcp&a@>L]wrɔ S j 2:2TGe k@&[-^H!3oQ-?+MB/24 5@~V㳌FL#K.hXV)N&YĮ*h)F=3vB@8]f7؝0 9!ra$'9ÃÎU! E!@hJ K~ /<\/Q6)8cJJuS|F7Ju=<@rX,0p;iG|lK[t$KiYK8^QKmS`30c9YXƇ? ZpolY|R)VDe Z@uOK44lLuhF\P2e.qP[ HLYFF =@ƁYޘ$.H HO@H-| QCK8WA) r)z"}$R}u[xM .S C-#ޤO[0C3Tm_wr.Gj&O-i!j)g#w).I_F n8k0fy<<>VUy20R.[:z`4]4Ad;$Ч>d4zH68 h4C13P 'hK$]硐t$ a^!7 r:!`IKb 0Rx҃)qwaVSPS1 [/ IwwϦ0K)%$']sLͦpkNSlA Ig!CtY;h f9h2pm Aǻ^9Vi$R]&%xu5E{L=%՚"2E{E!{[ZzY- zXd|[7N!0*[d8@X["5a0⵿*i"7i7{i](7-'( *7 )p` ΏD}Z6> QhĄj*m$ርa YZXj4d# LzrU%!qDIT@8LNAS@-!yUL`  g C]A2A!%ȹMh@RJ˕XИPR M58Q㦫0[xLy<C©ퟵͶ9 L﵏P#MB^ Gr %:5DrLhh Ltht*_#?a<H?^GE|` )M$ȣJ%#83<Pn㩁lcZ^r4bLD`(rHM:i'ҩ_ n8y[#d(2+N 'yML@yE`PO`|d"*`````]țL``dF``=i`5fd`3q'ᗣ|``2c!|Hju}{0Rr3^)hgEEr͇UG0PMb"[yMvy 9 <}݀!9f!3p6. 'pPX6Ggd=B($  U$c VI0Tu g Ņơ HMpT3VrFW0&CMPÀ/CdJZܧ:"H;rBz" 5"*PT1 @p pK`# \5ȹȹ&.В9H2d_ tj_,8,\OH<;׆EW˻e!T L8 $Kw! Vrȁȵsj+4" vr"8,9ɃTu!DdJ&9ƌ8!"Nѯ4 (N_I.PF E*}I?KX0u ( r%AN^ēNhѠ@u,ˑKD""HDȀD"M "<*Z ANw.kD_%/e4<:>)QΈCE"A2E Ⱥ!8(0BN#QtB[^/rvH/#LH6 H/!%#P-W1#d ER"FICkA*g,G.$D$<r#P#P&&+(\F@Lz d@ 人b!CAyU$X/ϡ$$.&/9 $$N!e$57BV-|^+D}0%1r,%$40$G0lM!$ز%7$t0= ?A5$dɑL`rȸ%Vظ`Na ldLX' H f%$Uq2Ɂ%|#@rZ"%ta@%aPLp$$e@pSPPZ"lEkkU.LjQA'tj]{M+%j e1PVh%S@(Ir2Ȱ% $SWi_`#KN@ ie@weq !ҠcHA!f@ &tPwpuY{ @rH[SH|GBxCj GϺJ@e B7r 48.yQC]t ?[p#--#q5%}.`X;@ due=r6 `6[;O DŽEp O<ŷt4=k8(T8&A_kSVJ4 _!ÜGJ0 #);4L臭P<AxQPT"'$F! jLJdƦ\C $>W9uZ ʌ7.p%Kp@n #OI8E< `gjPGPDApH^M<+R }jPb/| ;Ig  a# Ùrj![)p. r@*#A=rީHU ڊ6rMơ82*c3x}Tf8h`htu BQ>c\r<0|o˦BLV]r,44)>CPxb[wX ~ШeBcQ@EL)kC`k弴FoOԔirx8! @n9Mq/bakދ 8EDR !WVu|%J؅c1I8x/|/ieyؼؼ!BN|T*Ԧ9YN\$$wZMئI>8Bj@#s{J&r2}Ԕr$ 4X5}()-i d$ae 搫 ` =Y}NHU㔼s=q} }!Jz|Q9⅀_ l%C@C, 70O 4H !&h6L ,h6Tj)F^#)&*5@10("j{Z{CodBJwV5<*8 ?0N0V򠀭G*mB^şp 5٫EqPjT/YC#9S1H!NjxP e A|A :){- )C)Jo }Ppw0Iĸ4YDR:! &RK$uvGIY K|e;u]7S2K0KD"3 5EzF0,_9Xt!CPZ ිq\SS49EwEhA3  CX5 itzD<9QD`a\@r(1*yEfqX ;>@Fnk*m!`g Q^tZr, o!)QX P.W"#|H!,hB@٘͂0DÓE4tbsH({x Zj:7-}$G),C1i ƿtA ]ôT=6즁R[bu&舸OUaj3l#Zc ۺ6\k И0&Nj-VF~òY"]-h%*3PaPҐj4uS Qb=#^{Q'_DP1< Ma JKwmQjC[iubulDbl;[J ud5'@wQV1D< H/ *5. nGcEApކp%vj x`|#S$\,h&=fc k6;8a`Dl+ p$83|emLĴqa<+{9]wqB38u0 =τ Lpwc &Vpp `xu!O h0Yj)l8MLm$L*t`P+idh/JXL 'L4 q%LM ^ ml9ۆnrCHꄵߦݹ9kSQQ6w-Ԅa@e˶jpp@H) bbjS vU2QF^>P/ R0icm#S h9S1!N_X"WP]] -9 `75P u<5uQo'+L8z< 0ĹAFuF@]t`inؙC`_ۅX%,۶mbɳ~]7;G A J/ 4rƒM'H0%T|T\|BH'N a}{Bz3 d202utM|#V6QctL,8x-[ ̀,p+ " v`)oMv1}u5j|1:0r 9w "n2[1Am2Z|rTu8Fum'ױDϘ- " @${q| o6u}nIjǏ|[:,!;Ȑ1Vr{ 1U"A ֞k0ZM!囷70<Sq$fZ}=3 98]$a(I)+E _+)KJaത"3j ֑i1"PmP"ĂA )x[EVpxH%^r$.vW%@1i/2%O-bX_%̂Bv{jXC @I9&C[Y%T/I4DTC#VZUrhRt㗭;_Y$Ap.[_U4蠁D ϛVa.U(\ 81ƷumK"v($큍!UA#kCA<{U#j\P pu'90ito 6 fqt JFW0P3 8u(LBf <>xl|@ iUxρRz3V;" lo\%UPa|Է"SWѱ D侐局DBAbɾtl 2‚>]`'CU(TzX>;LD%V>WP[&t% \t8m4 &ps 6SmXS?HñBC!942Cª kgPwٍq<$8$ 5®!? @8L*?$Ue6r(d\0%, 4$ 60z̘'lYYR;KS (%)O(m$14ɡr8'<\ L4 QV$d{RAmހ̂V0F= rV@4b0htЫ{lQV,аH(Dr' )}ʇ0p-0#h1d\V̭& <"0гǫ Aa0å=#Yl@ՁU5lVEou9Et (t 0܀,8&$2KmL<龷jSﶱZBvT)lL4;l]0 R+w.Q'L@Cv]d("NJZ.Ra30M웵!s *pL=J#%A=O6( M 8BHa[0!9MIM)F /(#W2 0`o7> a S* @q%%[`3y7P zBACL <<1:!S'iLMTȐمA7 L2 < Xm)HLD5A\J5(({<ۙҔTxGsɅSZ: A!]4@WFbΘWrQRS `k*6S0MMcl$9U@I2Mє*B%y]@A" 8su$A)qJx^#TÙ8 +NU)DW&6X!fI8^xt+ `tq@ ;%Nt*vKpxT}(BKNx8%]~OFt;C  0BlZDP@^Co W 뙐<8L,Kz8!tw49,W'Ӷ&jik *jK]I䯘:~?"5TO ƪ%X #qm]Itno|DIY!<5V bS+u59 $TKZS)0zE-mbX4"ifx^_XPkZXEpF" N0i1ɸ(%o@\Vu sp!pbu.lLhAA'4@D4j[L'#gB"uBCv  445R7)H9t}wPYYG-d#8t $V  kIHma4H XDo4WFSD9 Xi!20|a h#U] GkplaWFMi?.i ݀D&yk6 pFÈe4L8T%a 8\|K$x-D,9@dZޛu DA[e2J^ȋ*Ėi%NY -cLalm#E:bS(}tJ Z>P 8cHxA"[’I DBZSĜVB , L೩҃HHP[CtnYf@-zV@gAf x />էYd d + *9L@&4a!g LVe ȴAŠQe @Cfgg dPV bi љ!6g# t3LH u0LlBgj*¼;#@6Pc##㈮w h|Yc{B` PΡ/a+u@64Wb VfCe.Ce$F}BA$XC! p!8:bxZX;ݺ\[Llۙ4 Bȅ$?gB)q5Q]Wt0[VLL4qVL)X Ku^! mŘ GWka"[f]I % -(aPˤ! )a+)M Dm'S!M4.MgSg<qh!@9h\ RW"PRӉ6[H6X e`JV:6i G$M\&&9)#&"p2L PLfHGұ1Yh< <)nc@IaYl"'N[ J}4Oa*\٥#^6e(#JT ́" U"WӴܼUƛ,j) 2 !Hc"YС42[A!UF8Bb ¥d. u@V^`^{[ļy%Ĥy.Ԉ`f B gCw# QS0d '6q{P\F ,'*H|*1GL ,/$Sb])b@PHXe9kEYF<K[v! Peh >}lH@9FTEz&' ˜8+WXWSuA JPVGagcpOXVNhKKtp o~9qƈ`c\ua,^j8T"8$`2rHPP,p6dbL0<(b{7`B@L]z w cM a 8]cs&/w[ x \ 4L^y ףt ~ua"Љ\P׉ q6t@PH="V4(8YDD@PR2DZ a ]͠ffMK2`u2AhUe\鴶2*yUA -р]ƅ|}\7q̴]254@Def3aT&Eu]9w4ϧT~>\1!EE! Ņ{o%t{tJ8@m# e ^/6!u>j5rM= ĸ4,;`E`R( n2r \ ͵##i"c)J& 2M#5 Jj)R˸CdHi 2P`C54QEEHe q \JD~7_h764v콋(HRr&7Pt!`B5WU~d2PI@7q)9/pd<8H+w9b/-J+qnp}iV#v{-lI&>@h]u% aUv ^hq̳ cV A )T0{yqj "7]dPt" 2$)];}V$s9a0]> !6_ n¢ ҒE} *a Үшt 3d 6uMQ]  t+Gkp h-7$*ʴn`v`P z@( VUGj5)Rشv -F=] mQRWl|ejGOP^ym;,ڸ,xVgSAR2퍛W/ 8]tWLpTU C2Ԧ[> z):ߧGK9^(I}}#oY.gW %rUdz,M&xUȕ$n(;@=825;]jH6LO;`X #, MF1fI |"@8yi)oICk"ov]/'squM_ܹ]5d#v W9Q@,h7B]7_j278 1l] e 5 ױ2ʽ ii,Y. ۱A̲E dtcRИ #إxNjԷ!saB:T<@8u (NYdT  s\h|ܚ:ek*pK-BhB&d@сUmS``Q` ''`]` iN2``v+m]u$`r!`ɸ_#_rVCB{( 逈G( $N .DT0! ȁSE8WV62F_j$Ԇ:8 ]DVTPXF4LP@u!A_ 8g < -zyF+%wk*ɑ#4-đ S!80L. @_QKN 9X>4y:h XH 6Cz>NďU|\ah # Ы( de|Io>\-LuĒKC`FWQRB+CﴠtizwWK),ֳ m i{W?v7gA_p( I/`@  4Іb3Мܣ?aRC*%tD%t@݋0(+8,pCEZ@6QC6 J9xpFj0-~ʾ;Wu]j4 O (pFEH5Dj WjWK!VZm}¼-H9=4CPBW'WpnZwܘ!je\ %E*ܚl hN ؿV1Gy!0tA,1 )~^+$ap"y9t& G:-gAAx^Z3P xxX*)yu%{`12(jPJZ-jZ$BF}v 43' &Z}W֌,VVEh*ql7KGsw. ivb/3}Rj[M]'$\xǔvchdl\寈M쉵L%W<#udI15B}|":@@LR@F@g1;ׇ4USht2;'|l?pd+}eȴjH(Fi%50 0<0 dfy[wpy$gUX#yF?\MW؀#O譂cK#60u9΅m#rPP\P/!h% S# ݎ+C``l`DEl\` BH!2^Ba:\7W4pڬB՚^vx!܉!BNw0o؋[ZЪSaZ- %n%o05 "%#@ A.:B i.*8  GX@॰}')[0QOy=L|>P2jh]q*@H *P6U1PJȹ($SM*iAX`#k]jT$Zr(e=-66Hǫt(IXӎS,k7O5P3 `|4W#r,؁9ฌ$@#qhp.}&#]їpA]ŀYdn& $huh0`A`[نXԡA 45RbowuH7u.Bc(i/DL sX,pa#yoHY6jcBS@.,]ϝ \:W2ejG5*1Hv sP0fW Npp]ǹFTS xK 6t@7ܾ6_M.|g3 l. m%`tHPG2Rp 7,f0 RNK{d@ҘiKN1 n%0dFLQCA6.JVeg¥!Fha1MNNk|tlR/qݬ*CONWdBLH_-2U*} :QHAQɔ Z*+ uIiՑd289\lVx/,J 4[V+Yc-hud Su$R (<7QWu㱴ESVV'hqM֑w{ELbHNf 2%W{: Ð[rhv Sr%(%'(`J\ۿ"}x9Fu4,xha5CyW$6v9WSmkvVSW _3p4;tcVHI`,R>"}bu4 Y؍C /mxW;'9xI|.;0Hjy<1FٍbOY: `b #AcEμ6'NBU0< XܫRJ9#; ׇ8p۷uCAcpS`˸ԍ4X- `nrsP& .`0lDZ5!8hr!#dd;S(@[dmOr28` ܘ-=d@U}2X)P#|! W!D6mEcvOSS“cQ\ mxoPU VWg̰$S}pӪUu]R=D\u\u|W "_s0lWK$ $\>3GC"#8(2l^]yN~8o`wx69EnOE&RK"^cA.f`7$iIܔyܫ"XvO4^W `+fen R1iS #9\e3 1pJһt ؂a"~lthL)dBHcq1NCe]f,@f0 * q]cV)7H6Fce}lc4r] qՆtւ=W.ae9(&s)-)aNHX;heT@$"n7a ]jft0nt.]ɍ0WP6r, -Xl L"GJ.d`p9&C.0!!2?x1LX6K3ɀ HMR[\B frFmǶ~*8gj6T0XM}!QQ2:kQ8?ɋtH9$X*_IA*aXHf+H&Ĕ;d6 O~R c"7BYĥ5Q8uOt#ǵi!-H0J[$,+aWI $ ,Qi I-a[DzH`uq1XRH4Pu#LG vM2(!4mHt, B '@&Y9f`1  B,A<!F|xYYw5i&7I!PIMIoI;eg0JIRg&TWA C t&2k/DAHCNiϦwU+!!"^r!$D^OFzza4tAff@)$ /٤EݡO$<ʐ@Nuij`TSk6H E6/ٳjڳL,A[R-yx_k= % +A &7 F"\Tx0!qcU4ЗO6O``K{8gtP 垀UM@l!U A \lo pH h01[ &`9i i0'iJ|x!xE"]ƄQ* `Ix1M+xidע 2bS:iPK/SM@*.кgcDy ة(6FZQ{C ΝQٰH2yLj )ڷ<(j(ã8jD Dɫ۾m``H(8- !j|dȘ4(B M+0VL(@r"fffMO$dl@/+2hI2!ڙhBVAAIvG>bx9B|E;j A`=B.yl 6XA=GA۰=9|a2 =l==)XjWjj!*j1Wj!)SLC6VuY8$τH Gk uq% [{^{1҉kA'x3M='!ԼЍ)A7$)M641!B[3܉-:|_ZOѨ;Jx(\&hBLT N`9=܄!(kiT5$ y+Z 4Xp8 C6^ ޑ(Y\# ;A0qV46OvD$3KY ]i d)9B& C)d* SZ!MpoU0Uy 1%`R(Eob)4S'ÃHQ@,xuk/ś^%|: ~ tt~&~!Ju#g72{ 9@@)O^9hr9@",Bؼ ;Rk&\USH'7jȠ:8^XCvҴWkpn&3$#&EզraPhH+HJ`86Y{ l݂ vwr7،,Hb[0d[CPˋ @z= \rn,B#$NPjģBYj]i3uʪdqV2Sȵ0ŝ rc)mr '6ErT5#.a;H" ! ): +=_]Œu9&xAB5G1hm9|B A i]8eT^[KQq}4RIOM&1Ə<%j Ŧt6X`Ɖp*prddkd$Dsʬ vi0 ܠ`im (rYcP1_:jhrW+54Ղ ahVu 9P-ȍMjBñk1B%t@ mZ%&/<3 C%28 )^O[͔<ӐTA7);4B26^8SH}hc@A$9 =Jf_ /F$Ht@4HuApC OP#&y$J4i4]NJC:8JYv+S_9s`<KA0fqF;Sr[pZ9yml\9RSiT9-Hm&CdȘw5Fm%k+ɗ)C x-{d$PO+i1BȩpdKmym#mǬtǠ03DCZ"4I JtĠ`) 3a&n[+  6ƃ.PGj&gǼ1E]L^$j}KC +D$tUOMހ-wy@F>H0&dd97قC5Nn6Y"uC:UN: 1 '|x)5 rP(ʸ *Cvv0 dy$SmC{<+&'1(@^;$ Vl4" ,n$ME+iCY0Geh  ]6 F7C m=U2 W^\U\%(ɕ\6Bҹ=b^-2p  .ZUW`Pp HKt%hDA 8D AbR;t02&7d D4/XJ0 FJ}^BP\Uk C }3S0CPS! M\`&.<,8AA'n,%y-i2f@f `<_$PLE t\-5"H=Ӭ kº<"V]Rl-nG-NU!.1 |F1t1 TҖڃ o"Ѐv*aQӤpA_UiMxx}7P1#1|nݠS 91bYor=A"a+1% y %Po^e5GQ d ӄ\!WN,$Kb{jX6H%4P @ Vzw0&#RDI pb !n] ),)٢O;$JxEU"+^TX& O9!B)F&nwk:#X`8Ӛ8Fl@R*rCoG#K O6줄ؔ7'&ACl`i Z;!BAyW << t < 3% /ـ9@1,xwE1aJ;%Z;$%fH4J3.A4J8n8Mͼ{]U*(1$, i҈)UXR, XZqrP*GQ\gpFP?nL4+ӊQe胮^eh58݋VibMrbAzC E<̯3)|p{DWwO^lh -֍̤cV@N.V$pb[ᆱ )l=ET&$xu\ywˋ5V` =<ƁFIONwR`@Ce@FSqG1YX%q7%3AUGcPˈ1;icQ=ێņJQv~e"+us MK-}/bSW) eC{ept +. Rػ}>p;;vx뀟 t6vu R̡V=p6j0u tv9>E9GvRO;-׆'-wPBۑ5)#h{pB0.Y&x-p+d }ot3Ќ j \ 1u}C.YH|MGr0,*LC m$kh]4r Efȫ%jBHtA4AQYQr[#W+̐%df E~-FhY3#ɀYLɁYP =AaM WMMpt>nK~G]&epR(.^wnS,D=9]H>LCYYm<_+p&r@+`tj-?_P{ &co]ɼŋma/KZ5"z> U8C;*비0ă?"{'(u FqML+AGT Fuw 6I3^3͠k;4 _"dUhK%|w J>ap5 A#.z? Pgk@d}{FFv֏ţ<4Q5 F 60B\zfS &SqZBcȐX C= o\541җJJ.P:P-4oW7S-]B}q}%Q(c19g}-f+X##F%F92j( "&6PT;LɸQGAㄣD{BH+Iw _ 7riHHQ0U^ è59 %V d`9 @Hɉ/h)Xt D%*ߐ4H9Bې @vq, +*NRJ;RTe?+WjH<+~L jQ[7X+b y(k$)8cѭ+Q6ާ)H^a !q@Ub,_ (^RAVJ^qT S' DpZ?X PDMa"@[ 0 HCVx<3qBI mކ0Q\ÌB9 BDŽ4m^"F)w.tRv="v t)PJuu፶J]hZ(D"'@~# `'(`eUL#@LH" l9AP#X)"OZ!< tX 8 PM%B@_PLG(tO XZ''OkO]Q,E3T_D!7;R8nP:ȥ4P6qNj@fSoL4<POΉ0ƃf^12ÇeoJ),wI0'>ԡb2DNࢹ}iൂ7a3F]qQ2Q@}E߉al I:@réRЄ4=[=|gt n(-D4wnW'bIV5]lpWdKzS10^a f?4-JVFHPK'Yw)h& a :] Et+ _tqF?Fz:Bl Ԃ3)v>SƷQ[S9xm v50'A`&~.I[T 7kU= +C< L>A4Q3 &KZS)<.o0@.zaM܎daF zxF0' t{룂Z %6_Ë%5Dm_Զ( Pd!LMZxI i5!T4o2\srFDw1#@w4R hCtI (YGI `,,#s*YzKoT[+u+5 _SX AKP˸䊒FE;EC45 q0[,<*r%0Dj' Y ym1xKSP2G픛6;J)a1Y+n .p yS[S.9}ZBM\ L-p%n G (%u0ҹ2\0ðGBMd+8A;[)nw෗%;S fۅ!VWdp D<@l`@RaWY-H >DM k%' /ܪ!LJ#7)\勆rHQ *] "|v-҄MD^oƓ9$x]"3mJ DRA#ip/6Vl9s`={3Z+ K)Bu;=t9w ƽ*qM/(>^;-,?; ZW9}ur ZP C4cʾ (Uw|.8cBP⍾a01dEgmoܞLogS0~ݙSKs75tʮJzwuƆVV #  HL@}(1WH /]bUˍcKpSφrUH7rd6̰qS~\04'[}b0ou!ÏQ+C(('c[pDU&Fu =|qqH X X,bP$Sf"u=g^k7]kiYwB!Q``?rW+Ƶ$S@V Y(1.@b+~@V/h g]1эAOs :W2+!2^x+~)>>9xǔs rZwEOߚMʅ_@1]a:0Eޞ8R|8jʺɐo ? ǀ/z9ٔ&y5} wiܒKHo0dG⒨6t /I(P֔.,>&Rσ}(U!Z(0 /6lJ^t;D Q.J oZH!E+ J ׀^/y$ǃAƫAc6N$yy-'?|ore$.Ξ12x F`P|i{I,].b@FChr1 e4AJEp]\t|P% EzmAgB˛GASNu+F3¡p U]B #Ɏ.zt(ْ ~Z#;"xu2oU.y$áDBu@IVzF7iF K G _\_9BCx.q HȡD3ywn3!ACE@ND" ҋ3G BME\( vC d,Fv(2 d@L @b!'TGQ|C!hr\ \|9H rIFw w"r<2rR#Jld( G K;P! C!:1BNL狐Lx4M0x,( xB db#LrP0N~ @'DO%xxy4XO̝xyȃ PKJ$K^y44l59DPy0C!'yFN Q[M` @v!'RC!r\ qjUk4⼈e4 d(f GSzMrT]z 659UP f #䫀Ԣu{#F0F-H^-Eλ2L#l$֎YXRg(oL.ҊMe6ݶVH%\qȍ&I N0/lk_ )2w<3 `eٖj RR9')& Ԛ"f Vcc:TP{8=XI{L]f`_|,LC?^Wt+y7{T{uɖQ"h|؏\ %jAZ' m9y  slN e;lbaՒA,6 0fOUQvεE 3<҃ύeJu$sH)6g.8bZVb? PyQ=UyjNAPbmrf Khq $yrX bmT}e7ZBr8Ȉ)JdkYvPodSa7G|[W&І1dEc8z)xxxW@SVoj|!F4u >µxKI%ov0"v"3[vp,lb  [ F\? (e9|1%+)ٷA +q,vZr{O'˃Hl!u=ؔvrs}QJfj@9|ԛ7sY/{9}. E+Eg ~zat cɔv3>t"Īdg Lr2܋yuqqM- c_6;PP.UH!pu ~lS%- =}_I7u-ely/# -0ɺ ]saEb2j~h f<2C `3f|p\h4  6cG,~_ҷUޣMbCjL^dV^ٛ`T8w|0ya͐uhHͅ Y9+t)0 5f$"o"ߌ@.] ROh{]}#Htg_L,g\ekٍt#oAnQP~!G[/0w d`ì&={뜔9ZFsĬD{K?aΤe'IפRFVU4U4"ie)wRH}OҠ탥l&Mi 5GRaH!A$N`糰>2Uɐ+-6/®]c HE1.I|ɡH ڈ&E35GW CS !$=;H?H q'%8e\hke/y'fi܎j5bS8b;=䑥/ +1ب½[>~Wj qGxamI@ q/3Sd_o_7lv}JJ Ղ.(Hۀ>ɧ1*HH~3]Md(b@Q oUe -u6_t؃΅6\S> ],o@r7/Dm5.5#0-|3t(i`@G^ Ge} IRPY`er)( &u2:LNu@9i֍!~+fB 7OWMPy  4X7ea Po~*c ɒ2BXG,o=D%]P'tH0-9 6^YL@$3fWw;hd䎍!-nKޛiWP}w+]__V'_\rBfWp_DnEK\F`g <ڋ@mU kTN5 )غBT/F t5t ~J EbfA  Z^A @8AjUjHi%$ސ"N6)BnIܣ-Ы6$(b }Fi!iۑ]);-jKSvZ 5vҁL;˺xi*Vq#\rk ,w =},daQ} C0y&$ЄVRBfL+f5\M @ npKS8 K9kMFG0=PrhW QrYYQu)| u)B`rhJ VHTYru hi 9싁xE@LFX B!| LWy*UpuьWEH$'-hDFXuԅc~3EK0le!]CQt9z,QAqŊ۶tZ *ڷȝԴ^C#}OSvkJp7l5bS@(&IECTic4r,V NiTK0`eOPz<ȼS!=MM| \c2fE0+Z !GvxZjќ! EKs1 [ـҸ*w($HF*E({N\K2+"_;ruop47(uN.9uuÍ !-TV,u& DPԀ<<@Y@y lH`Em74LP$(+*`},4x”X)4RX>w||U}]͐ZB8U j(½i`̙BCD) F9rexwS! 00fz IE0C`l`>Ր=VCHp. ^tz d(CH pGHmYmwYJ5} 9rdnph]j'B/Sg^fi+TT#L}eǣ4:SsҤ98r!O09G>5Szn^é8t f!0CCM8UHAǡ%xP ,ˀ^[%]Z@[ 8Mqf@UHfUqsxThCMpnA_QӔ6uU{H-TdڛiYNUcsYoE69J2j@F̰ ӌ$A'DYpw93mȗÁՃx%; p/RSm}yx.:HRYֳ nȗ7Z8PQН8#ig7Hö،\ 80@fjQ-LH9ZhrlSK'SW->/~Cf ^H)M [B,ljAe_,N9% H)|+H3żp+cФ'ܙH 9(c ,}K cp(}Hc?"@?P(} 1w9]U {%8p %>F6HEK 0AOY9s,.;70}5u-.I@ ns$ Q)/C߰\lrC+n `mw#[5 E|fC@S)y.P( 5bHȐKFN24JŖ kb˺Tkr@*3,Ev3E!A3\3pF93=`2i3B|5PspT_%U *e_u[38z?'x) ٤QsUBMȔ If5aȷ>J(@]B5XVAH n]kU"y KbȄTvs2$Vvh [+N Z!ݷ3Iuv onMV9 yl0:z(5 -vkg  x{-AxX);+)zu 7tp. *ZvK^DMY'd'$Lk*?;uRKj{V!A0? !?B!]eK29KT'eXpKI K2,4KVlX]@6PBB\!lr̒n:Di avк+кAni W 3ɖeYޭ ZeY $(,Bv*HP 'lн%3=xJ}xKf3 %zu泵'BE|'$BȕȠ@՝BC!5[*m:CRBh9ȏpV]paHC !-YAN.8~_Xd 'žK‰̟(!d%[贅__ ti;D@0 'зZ.cQMf Egb-g*mtQgh7aI.Ua_Iury F$^dನç0)d00#<@iL00eg):0uYć HH#0eϋk@SӢ;;dನ d9@0_E0P202\%H! RJ2!000fS tA{1(! zVO܈nCb@@,_wӗiʡE9- "ր 5BsPmr.ODi`U ,"ICN oB"@М5GD>č4/+kx uc+&qqwA1Ew;N‹AhӎHOPPr>  & B17!7(#A;;3 UIǠZ`,BX PT"ws$+X_#5b\cU5TW-T#䁐4< ӂiy' _ (1,jEhe 6ׯksx(X) {++\/^`Eݮu[]+UƄ6P؋IAp?uQ 3(QB05W7"`3K5({MF'=&#PaӲ%C*t p+ "ǭ!6RoTJ#0FS`zRkN 3.<Ћȵ6w H8Q=q(6p"bz#-LECSdiTah ㄯ.y /W54HzE]2IzD!M ӄ"8 A7SRK-HG*lvڗb\cs^@BCB:$(s M6unF K`Coq\hD_ſXtR߃vEWw jX0 ʐCaujHhD)9bȓ0S9n)M2pZd|luM u\}U CX}`dB3JnWiL=ĸa)FS([)]+q)S&m_mjC_t!h !+@GIJ谢b A"/, [F_+MI >S! Up| ^7"~E;!"]չ݅]C_S$4!~l(Y<|U67U m*_S6X2N]f!x] Аi! h!"@] &C BA kdG6zL&I *"Gd K6Xcm JȘ [PE<$a#s^I-%'a~.Q/)NlG1FHM*;b`[ 4\VOr{4!CÐ ]N$͐ }q7TRMq ʐZDjE7`tJKՐS½ 5a uET  Q,d]Y Ԑ㈀@8~5RkhPd :kZqI䵵Kؿ]0D0,(M 2PMC,(܂QKIO4xO4]5|rƪfλHH iaZWs'a dX|QQ1U\[[LMr2Q(٥`B21r4BEEac:ci'1P>&Ɵt txXQ .ߒgdyd* AҪ Pnu&Kԉa!ןрXӡu m[=y-E>%f3f; G-) %Ӗ_9 t4 g`}e"AfIMO F&P/z_R.]PD|hk;S@- 3J셤& l '*uG/,(*+;aԟQ89Lf[`'BYŤ:@\AiW>ruZ:mZ.ȀnZv[-A`BNe]->];)qķ!]`]C:j׽D ZHVɄ3 Q+F`!/"|dP҂ 9+_s l.Rhcݠ<,% k K  <`< 4 *@L=V$M Hˑ KdY^t[{Mݭ;0ФB˗mX\nq%˥˦M8l\Kɕ)+) l/4V0@j˦1@ en*.!z+3 =u镠@6಩ldo~+oc=6x5\@A{VV಩ ni S(t|[ws>` ݀7QٕOK$j r)*Qhp` Ud B!. i{Ћ#WdJSReGgy t8 <[ 5@aEH`#qQ@8aC:ȇJ Wwg#& XhSeHifV!ABȫ/A@Ѓw YN@`F JK -=J 9Ot,۴'cU.6fK P0-Ɉ( fAS#SDi_)4̙HP!bI`) i"W.PSQ䠙4w{DVh% ~ -L2<(AppB2R0D ̧Da 7cAX>~FFr#Ass4bdM]JKބIU CLX_f;Rc6@MP݇&pN;tҟ=>y\}}?_tci;cK,JWeb `LieWMW!!  //>"4ԙPNjV!XEXG0p_oY4j34d0$$Dn-`=5Q %QZx?#"1fR-9>W %}@``9ޙE`0D䳬`Q,$7:P8ԅ38r\% d~6B-ADߡz0r Aq€y@v$] O>j׆yÓ51c|du8V-9]BAKUS2b#LO` U1H 'qusHR۩O$t('rwh"V#9@@-P5@`t;ۉh._@YKB1ch(A"ےF~«P귏}IJ$WǑ"^ SeXj0͖2MDHwi@DCFT($\@8WlA/EICjo[cuD/H@nv`MeZGehT5  I8V]#9 2<\L\\1_A$JLKAH)싼9uУ|p2< \~ ~=MVNC?j~8a[ e(PM#)Ȕ\TTLDfHr(G$5½[~29@Buq.cd"Yzklt[EH=ZaEV-^(`id5AƶB/D% AL W$rϼ;R0\ƅmi7*5|VlFc",9u# Uh$l'Y=yw'uy찭 ut6ݐxj BL6%̆!NV0f&V lKIyh|3hjhdg`viBZ3+ YvM?Ha0x ]5%y] $V1]Rh ZMISQ] W +}++}i0t1eO vVӂ5_3k3;t!Vp S#l7d:Sp®8b$f$OTd.ǓIwS!׃W(#sn;(ύq_No4 `-E&,^vŋW5| 8 "؟+ (hqױ;ؗ Si"KYiʌ"1P>`cݳD iIH@0kVǃh FT0E.4@c$IKZmj#χLc["/6(e|_L'F1 c!@CD8ھ } Fr#qP_9'bd7չB<wPyG*3!g腚^lhU #.]G 8(Ǡ Ε[Xi Lt d,nX1e TY0#lu X=ЂB4%Ht, *KrU\f\G`vCX}&ngl6QҠXpQ(EV$rpu#99M WЛ16>˲8qpZ9 }O,<Et8t!6%kؙ0,rj !5r ,4\|@]2jiaLP $+EjYkҞj߉=r, [.m1%L\@8c_vlA M81*S/@ *GJÎ 9("b\x8TI_zX(.;+?QRW⌃<9iLcj/o-.ho`U@,Ku4pUXH/ yLT\`df pvfVr3ns PX!)k'.o@m_0p =~!9Ȃ#Ͽ } :~5Gr s=4ȪO lM07Ĕf!^ΐ} >6u7ײFP`( 33Q,UvW:Q?b,[5]OSccHp\0od`bLA,o1 YY .N,@ $RXklH(qJXe^yZGЈbOL?%'d5T؃Ðvp 5=l0Q|!qJ0S˒%SM}r%(,jRy 9H=4B!Drɉ[=` 1%#aTZrfHyQr>=fJ>=x h-g$ ^k>t$t1s[VK8S^ZH'd.ÎouY'P($>`r5r HLqYO0xp@>A*Q ` '>9Ld?T(#@,k!"J= U4_4Q2{>59 | x X̳=S(0P3d jyx" ?e3ɊK`KTM_CGHE#&^FG=3ۢFE%]*Ȋ Q/H,P{CQ @&@|?( GGאE 1 | MLZ0Yâ+ݷ @wR`$̂MV:q;h`(BfF!vo/,7MjQЩ[A^f19Y{ |wġ{~_R']cV] ;F Y*?٭"H%g FVCpA JT9Qt&քdkaT#wP,jdptڸ0:vS1(8 f90 - XtBnОR`Fj=)k BBP9y%6G"!a]};G u "D7YS8!YI"jKe N B LX^1W05ћNIPsIS‰e^I +M8P] @"1rhY^0kW6eMSAAQ^)H`6=CY)hE>CILhi$0@]FHk&мdr =X<%Wt ГWHÖRW0a"N =j)+7^A?x 8: MNZ4SH….qhA-5A:zQ\PC"VAt p[zmYHvօD: N>W,}9YX-M,^'H81B aPx+]Kq58_K} Ktqt5?lO 15X#JeHh?K>;E_eIv7%P+$og7mu ;_3+m ˫t|;$u`>) +bɺsKħLe|՟[?6?! uVP+Yg6]N}a7W@~ ,4* SMy ,IM@PA@~AV 0XDC BvePVl"Py!*J2BK_݃ξWiZ< ڱ<`5߯;wXL GhN VFd(*CZ>شYȫ(=a?YYNK%e"뿪t7WXdž ȑ< 'ȴ'v+9#.DE]M0Dm OQC'OKiqA%pС Yf /tB>bP<$یOjJ7vV6B=>FdJrWwJK{U;)0554)|5OwNiR)4Kdu tc| /u׫XDhitW l "%-!1pМZ`2i)얔6Fc)-q Q j7ZUM+uث+7 5wP"A i(;}@&*m j;~pgC. .~ 3;.uj hc!"+ q4fTT3T>)5fhD@(T??$JMm"ibD=5Dbgr2b7 ,nS2q)J$$G$qL@rAM'A79 `흤D&u"E(y>>REQP+$-T\vvF^ vݢ 2q 3pǍB$]wR`{̾!5Q ǥ ަ$C^P9ٗVq6_m^b"AJS LD\ t0v /{0 CH5 + ^-Ì+ȀPRē~648DcL[@ (r547rx}yg8[}*!}ȁ;Y]a`"I4j SxrKjnD16rC @WG8XL!41ƚyx#-AVџ ;`F8ڄI}J ;EjBkFiC NAǪ1#.Tɘ= aIQ16”QtHCs%,Ƒ׽CkW/>>GR+EMn[BQ;+ #{߹Sgj1q7 ;  /◶ASPM瀭Cӎ7 [_PcRZn5Ģzu\3IQQ Xt+Ĉp#Q/q Php[SxjHn[I|g@\W{dxYAL4XR,^Pa,N`CV\Aok@=!10~<6T6W9;pS|ZW}7|Y1`DAo4QVH66J8H0‹bg4LPXejՀZj"^.B-ʹ@lYZ9 l&^( tHStxCou]Ej" hnKx̡Saߎ]g]l[ WѭE8S+@NQs=j}Z@z8^vØ nP|7aestP0u?TQe!JAɬSU|+_Bc  :u}0OF[LjCStpv4P8 n;2 6x4gS&\R kVaVۯne_~^ +>+^oXax7W0I04 7kEb6dXplPvw]Li`p;xA`Y 8 #hb@8m(A Z`"M)0>& )yvifкjtIIaM7yh4"vW SCrhK DXzn=\_-Mu:)YQ7UIS n& I:# .7%b\G1BjWr9ki󝶔aS2FOIuSW'Z! = | sG #j*w|AY昁b0 F%0$x!$~@?bX0p6Q-['| !(J zE^,I,{FDW&GlE+>dž Xu&C W/j`t[E'l 0e Qx j",$ w`h= n9nȘ|8PHdyCÌ| ~dt2-t^-(ީe-"dG%b+k0Q. J81 / S\|/d J,LB4Tw&XX%)%88 KLl,R3bK%VHUbe37#-KHt0g UJ70/b@B\Q&KAxcPP"gHsR2XK1*K,\,P"#Lr 1 v CT#@V@jÌ!M,4-9THTGG Đ)@4D")SJoloX(Mm4̴8 LAC3R$!*L ҒxU4QW(j p™GA!A8&O@UM츣fMypv* nXH@ѳѳI6_+Ч2bT OS(A+Jv`Ȍ,Eb+pDRFT$4n(ÇdpuXKYKR,swˡi%ȍIo8°@-ֽFh'Т@T`=9G$ l%kEm E=Ju^ [< m}? eA+=U|aQ x9;UVu&n/' :#Ο=. :P 5;׉J#,op%SuΔ)8؇z+='f fZKu;+0U ?]YIuM's( ނo[GC4,Y#.gw{ VK92'p=HVH[A.<}UK (kh>j BN4- f4F$ BXP&? ~X}BC]J>Lڎ'hsW``^# yKj?T|nB!f] jw@gIq)$AWSj `I\EO1>g҈,KuK!v|3銽>8Yp! D`Li$%ԙ ;E PO{V?#( (! p=L!֏De{Pc;LN4B6o ])3j/ \},Ì0AB=ٵAG7d$SHe0QںnW㱦j8}!Z-2y#9v,KiFT 8+9't:9Ycouq'ai.D -b?e#[%0Xj_t}v[8A E"kk "DPW H. XF7tRp8:$Qt@4[zɳM۰Ţ ebz+ DX.BK ,2p6!0CSWr,x .UO6 /(Qj.AJ8av'zl X" ԓ9)[ ,ܴx0Fn] +}GK`9+dl_7aZ;3Ro \P$ 딍X̢61n @ܩR mRN,  '4h˴64V! w#{u}y8EGn.<Tip:WqXxa? (R :SO1HJK2FPi$yw@G Qdd09<ڂ*R~Y@8F:  KN[tXXdXfW`dhXTe]0 ĒVx? 5zڋ @= CLF;/%yWUR%L S)ԓWGyKضNZs%Ɖl hX CHk}Z!Ӕ: VE;bt0d zulpxygy|Jzg*i8D {v=CSS 2y#ͬdž@lf\sl |: "`VnBR!ld SRz@Wa:7rzJk+Dqa(np g_Qu]H[Cܠx QxUT#QQۯ.( A & XRE<ڑ( eUd\}d 9 _"L2[Fq$tv$1M GDͭ~# ]RI_S`PQt9SAiP|N[u')E2RK"IMR RX?ӳ mXBǜh D Y;0unhNZV-hxeBpFN b@ƀ.YYD܄.y2_[jUn=t+j@\ē'E9@81)n!u,Q  W+“__0 I[fX h ^<>VۿmU&Z lc ze 7 p-zhKX*CO .c@aƟ"6'Ө l @# IøWVbwg*t}1n@*vKA`2V^osqqn8mlx4C^ 0F h +CDAݿE&`+ZB9aEйg rAe/,J͌l, JUP0l:O H5$(R K'4p-x&y[YPVm&p{Ob D5(a/Ca^E $1cOPbDҤTӤ)R4DQӰ!=Jcߡ*@#:;@A}$O/DOoEN VGX4!7L gd,$0*"etHNP=hJ^(`EQ(T r.(!3 Rl 36\Z#DdwK.h- ZAy|6n[xѡgCm^,G*hè-hC$.F7ft*/XdžR63KCbMP=}`uq4t"!po lac<؈PuލjwLdq%lC|I- V`uߑ ))M狘_H ?T N<;u؉xn@_;!aw[ jY3|7cL!,s /Y*m7boG?Vkh5샄y_[Փ=fP^N27ENFDŽ8h*|IE=,hiax z$YF|t]EC US{,)e;,kA22TT7 LSf8r֍$(T #+t@S;s0?nSg4-=H8^-'`m`]92{3~4?Pm*Y$qCu7P#lm \S̲2'WpKƆ$b VqO2W "?BI!|fOj< @aJ&KX@6q n=g j01Xޅ,xc! >t%@TStH i;OE]ӨE5^p#um_H 0|$=O t%A+4RD(9De@ ,,&&lCl4YO@⤓ |,v'!ZD&5FNQ7Nç)pqIf;Tu q$b\\ єQ0%0UT (@9lL PT=X}͈ K63tb|< \5Y +%C+y;P `<,`Ո\36 #-XZX j,݂rb ρuEaBz^u+VZGQj FG^*2CsY3j8$Ig0F홄[ dnJBkEXP뺨@ ye; lTxePx9GT Kp!j a4hHjPQ2X$02!! ^(nqex49J,pH5ň jX4[ 쁪 G6Őv ` 背Q#-3T W!pjo @Ռf*m` *b&AY䐡A >`:l!P 6v+mq @T\ uyT8Lwih{94u&M_6PCtES!LV؝@'jeXrl K&SYUYr$s 1;M#+^A!R!WPG 2xN}ɂ5y.7FjuVv}ut0>hptF*/ )vڥ^!rwr䠋Xf#rq#14# .a"'axs\F+UDDMHqHH,8@Le [*^ Q46J필Ƌw"œ A" ' oOYL) 2P )y p"M@t 7p5 1MZpnMYXV];@׍wMV! ;uH `@ d?za dSCzМ'|)= P"NVM6`xecr|t9!b_jvm Qdh@ lBMj /ғz}o@m}dkEZyXYjIĕmFYW($4M z%d^un4d9D80mTG j|8yu~cOI"%n=B&VUqS}+kA=WD-S;8C>W${X_O4" `zF!Ekp:9>w#ug9A~Iÿ5xL $6Rpa䒌F% 'tlDzv46D R'#'#%mLu.ā#2$@ A@U fƁ5Y툀0 lیYYPY;QKU-y 5R 0mh-Fj\8dmP G')[P "~ا^-pQdwA$ģU zj.P3Y;ƭiH[2OM0 _Ѓ| ^_}OTN<ΚWMB>7a,{ uic.Gٳ"96ltdHV CK)POluuQsgJ7U 94?G0WSH ]@>CXܒ0\HL:;!8U$Kd2QTRVI3$ (!2?6C\ |VQQzhPh$þCf# G߃[{%qA(ĝ(SHZc),`(ב.]" *f0R#C %c zvd[l3(xH ґQFQ8LbniVXS5*Z2gXdgYn)3'[zj SƓ4/  *\ <+y#ck{D%i4$5PUxݥ S}FHdkd!E[eqҽnwLRa!`1k<4ޯ4CNed%as--$K˺ .aS}CŘ!04 2 Sr4uvG,6웠`Q;*t #LmrY撍Ǐ702(kxE$MP09ҙ;(kfoܳcRHj"\_W20;cQAUP×V=Тm2j= ]hFq$s B OQ6Qis;t!Jk6)u-X;]9f^"lKK=oюSqp a<Gܪ i؋` v#- WK ;!*Ab V _L0?A6Io [VD SxԽĊi"@K ,mpKH).AҐwZ <x$0a8ɚw ] &$@?c 03!&Mpό3t߮]0&\S܇ {t e<5UV: ikc*C˂ltrz)M ,SM w>{ IYd>Ɍ苎P)l"'mYBtȡfOeQpc;^XH q 2noPg1$^P@;\WeNk5A C6_BMcSt oD !2HFLsZj0PW+\3`ŢPRˎT!FegQYg( U-88QP=eOl+9 Bߌ?@W덀/mi0M <<60vUfွu .m 2n ;OQ 9I`+%ER/Q=O$+C3ߴ幵^WÿW#Cio#c {Q} uI+ ^i0e$F*ԡHyr!Ӏu Z UP ¢{n]hNB?.6pŢg@a"72kd8 䉆\.3`-eRk3 Sǖ ZDͦn[H"Ah&-לAg8Cr[F5]%J܈+, R59fC3c>;ܠfdx`Yt} 8tyWP, t2 ]urΘ춓kSQ45!iS0ZruK@]]theVanM@XV?qi7LFd0x̄Td8e|Ou  q1BZ(i`6 P bF\ LGmO@gdaEXSDxQRQ~܎GIMkċmBhF+OE5rt+@* "439Z0«fn.}nPd(!Do;Ȧ >e(-3 4wVI}9mgn%\/ KiݎGC sşi !C.(";!(X[;uM\0WOl)WZrj a܍,p]l ZS3uLkxnCh96%Lt 5y ׶3(CPg.;fHYI2@7IR[bFsONތPICi whF{p'#0taٙ V%[W(@!h>(!0"&DB hL$5ehp ! `lu%2bg@H!&'`(jm\e%)X8&:*y]+I'\0wӁ}2)H@ o;H.=,H-./dB01A20*(z=m&# +3#4L 5 6*7895B"lL0Y t  xut%$O;B!IX([cQjftҠ:>g G`he4i^0Bk sL/(zI H QCmg'8=tM˰ޗ mj" 62AFp}PThZw!Rr셓0⒡ TYAՒUݠqʳV 뻥8W"brXEKYZb0 μ:%`*m8HnMNO2KSPR0XQ$RSG;l_25Oʳ@*t; Zj"5v'T$<UHs$-HhktwKd 0?@HA:!BD}CAD!S\lEH>HFVBGH)XQu_*IDGIOJg%LKI L.lh 5\w_{U w(xy!Sz{ yN2|}BAGp#9#qr 9s"tVsuޤv) Kxi9#9jkl xmn+9DorK$[Hd\]d^_E`y.aU1(UHb}cBdeXf[g!hwf7Uf0oHiXݬ#9)~ 9h<'ݘ \d(  }8eV#qyX s9!Ϋ1a443^S'}ˆɑ Պߗ\Q' |#92=P2k* 0N(#@:ՀUI 3`[:ɑ\!ȑ\2(@MՒɑ94 ɗ7CoѠP#>cjWBƙg`[8% Φ #XޢXEi0W FxIW[Y9 z;Um&=GtLm+mS% KRc(ER? K${W}0 s}9_*%k4Ё`+ _ĨH·st9xPP8׌wW2Z 'KHs]<Q|6bX/ j@p 2`C>NÓLCdK]6-Ĕ%sW\7b[o8LiF RÍ{Sx׉OVEV S)|M!z5R0pC2 -WzJ?&F^;9TQIYPP0J4plgeWUshVRq`Z6%sKakg/` Kh|SQE LժcS'I@dي] `hJ .H*Q#gЊA0:QVW\czٛVnT8]  ]D Cr$h"/6^hS䔜 ``Cc7C1M(RdÕS05) ۰FK`gA Ie #b0Ž՝2llq\PW[:0A/]֞5*\S$DJSbSed:%=629WmkHŔt^7)&0@ WqG8~v >Р^6_$ZMfP(iIAĪ ~& }Wȷ*P8Xn֪V`CV@̉*,VI%#8{U{P0Dn3zEݝO5BaD0aza9IC[DEZ/+Um H2  *x/9S6[W AfF%y`,b`=k$G苍%eyȁm[|J%?ܰ!J| k|ct!i:{--QH1 q {dk)hSxuPl?v\/бtePp{RZOk6|Ttk#@m gwF+9r)Cbq8%!3P59/+H, l<8Q;KRYfxg4:jָ@#_±-G-bP1PRAz8{m( AHI}caC}G7668ȁ< am(, 2O(A6 P-ɭIfA r r v)]FArA&A&ZA&-%s k@NNȰ 6)kdyX)9y xAdpa@9l.h+ d=d荃_6`&(iEi!NC锦EXt=j"n mg=d[ Q` i"b'Jt^Dv;H+cEMA dA UR"T=4&xsK3E߱맄>Ba3O P"ƆUB<{Il5a#xbrqy悈<<@\1W&8,0s7}IăA'p|d'm [ I才QK݌mQKhщa"!fM; &iŀ]ʍvi|ZQ5)fRMFM(ߦ^C 7].li{k;ig_msN!JP":x!Nj<_5}'_E!CHH(^ aՔ[oVrm8IEAw!t2 PN;[i{wu ڵ~=7#]cMtDZYHq{ZoCt9)WtT t'D ҿ7W. P_Kl-C; 3Spt(n{:߃Y HXiM6zh"R伉D3Y$?kT2l!PMa<+hQ3QV0vջda2D#SY9jB|'7 cPceܩ 'q, 𞀨 c%Ĭq_X8n6bL|5`M]xu|#FΈ+JǜQC\-=/3J{Ur(9Gumlb.p.L Q(tpKl.jVI T&VwEGw+_".u#c3f8-3^ y,5`aE utB:vW54Ϡae,ATk_\$@!+%RF,^ƄqK g=^fPFV9?&p(|{&9f>[vBMnG-pt9Lj$30!1 $H*G7Q;?8ydjT/ĐpYᵹWi+v\`vC7eWT3Wlop&I.I(uL'EqQuu) S. "B`6WVk#*!AfxB@:Խ Aqdr,LARdN1ήhA$C%܌ `@ !N^$1æq:3tc9t ̞UH:!Q ,R[HX6u>Cvqdp 1P=UD9 Ghx3S{Aak"Q#t543.bvhƟe)8)0/uTc _b4RB@e; OB<ʆ@R ` SbdzO% 42di}ϝB@@A66PWQ%@;+Hnm .t0 -nwIh-Ѡ2Q5PB;F"Vɓ8XH@  yeqK EQ=6AWWZ#(= aN4M] +l`wX;O늑^UWoH'Йkt@YFo |&o 0EB:h3GŦRG @`zgP]QC,P`P> "ڽ3ˆ*L@"0\ 9ҳΪDI S=iMw= l.G4WXmy&  )Җ̯Yl8A`@# ڐ[}JDl7h) 3؁+ T*E hң!\qm-ƴ(K#\˃iS&WBs0 xjB`x1k`4V$) 8Lb8fJֽ2s!Kdx4%$Q2fvt! \T(8.I2k72q.!g* :l IyJyV=FY(}넆<9Ry l^* X :+ՂӞ:qPyTQbU7: Lr'Md PfS,V Txw<2N%6Pyn7eyYu {*Ԁth¸H@%j˴JL dyaO0 µܚjY% A'A,pAQq !"8k=Y^䐉±<@9`Ҷjqi%YJ+0S,S2Ap{g4&]fbnY:BħJ\iMO8.`18^| kɡ340 Bb! x[$`y[2nU H)Qh< d 7xNAX9.aISDz  UET6X; FӸPYU7Ԓf4VT$&JB!Nc%CyҒC@ih0[^ą٢XM5/0 »$f*2(L$E XWpK`gX3"GIXBDXp+/jܸb#,J it2-8q[lӉ;10 |F WW{A-8B$AJ 8" tƓ%(E,gwNްHPCƠ&lŋ]1t X'o K? [j;߃ O k_ޞt0kݶUE;7Sqtwi]@dޓ((k /_-n!fPbA; 6AUvH;F7i# ,2@JŔ|o̿j`:5w8VPt( `[L)퇁1l&OJrSvD: hAJSWA砃cy @dOxA{4S/ތo ֏DO< FG2x %rFl2rTU?lj02i@:ØOr`i<- O܌0XWXHDu4e/BK D-%E8ǽ@ CSϙu[u O@8e{Ww 3$Om3艽daJ}2PO`_}V'ľd D |nT Z^5۹ )됁l1Hkևv> vW d&8iυhsG4YYs(#gPPp~^A9r_F[LdžƙP 0]S@ċuQE-:h.@4pEdz eYYQ>_BS yaa#M?3VCuO-P4SdEOH`DYC,vGnQflf`IAF) ǀ8O3 ~]1S H &Kah-{v N|T; :@U-TW#-o2S,O4^ek,xPR4O8@0u] Bd Ga 5]9i , l ⹐9ŊgZ!DFdho FXWV@Vz]MM4l-J7 #I IR.WϭB#ʝ%G$W($]6ʡXDҌA7mb0#! *hW%  AM{NX;=&" t7غu~pH#W+ Qj%@edVmB-ᒥW2NG0:P.YS!oQՒT撥(&&<ܬt)wVpV+A^[X'jI`p]ZICx ehƁWH,`VK &'V훈{y .y\X%x9usuX -&p5Aؑ(Y@+:[׿܄)0ˋ{,"R,_Y@3c f?PC CA!S)`M Okq'rƵy RFR3 (uAC`$ 0ğu\ |,;#1p>84zvf Մ8{ S#`j8XYT*e6.K] $$% [MpR;&\.h4H))%SB@IOZ"$a3 M@7JWPPE9:$A:q:9WOVYb@ T<(ީ?@Pۧ;[*}%:5,PΊ@`Q#6 A>PYTY7 5A9'EH @xn.Ip?c:"ȩrKNg hRFUP5ȝ_LdhuB@tP,ocۥ2> ?ݟD7@M[H&tl ^W7BX'5r@@6A-HƯ®F%'+ [#’`!yLj,S do Tm̢4¬ uv;W4m |C|Sa&:t`mOԕW%x{t` ȤCQ @9A(G7e ){IX)?+ٳLߔ7m%N<~#ZC?a2JSW5@3|T$ KJ ŭQ%U$ j j*m 80B^q 4& F]As c sLA>s$eA8l%O90*m˂.Aas%K="@Q'02mwH󯦮LM!@F, EjJ.KO P4z# H )@VC<ĵ|L MDTD8wjKJ x!՗ B#Dx)=P@2U^d%hur=N̴K>"[kzz!OY5nPE-nE\:몦X$NKa_C> 9m`E/CZ #5*y0@pE,S'^E7 64 Q4S,jYHkw )^`tϋOXPAtH t ǃL2VVV.hnx_ mNuK X3VC>k hWVO)0BQ Q 얰C-0lEDEЛ$SEYFW/wQ)%_+/jMKS~(qlA$@mH#*ATdL2'4=C&kx<~Ƀ<6U'Mu=L2,;,$ 'lmUV5)0%QL`ly;FPB4+P, tš$0eZ;F(*wtZ%d 2A^,"0{b19tjjcQTX<dcohvѩSCN$KS:߾x7A ct9Po ;t.h蹤#E\y|eKOGh&l<6[At^*SĘRC9!VR;PHdxĠV@psa $c4B lX$d} -@L֛-YрtTun!qH7)5ڛ.dd$HM CGÎKp)R'Yx,ɂ4MpjtF[(SFyŭ0 (`%܍ z3yAlVW&$ TV};{%Mn!(17@HxL5k"s$ؚL@[L=/@<DŽ7踿(;Bd'8\@m-xR@* x1T{Y oH Z(@acWm(.yu  uzt`/@:ZuQVn0U a8^z) u<~+l5j0V{̧LE;wy"En@n B$52hWd*A@Dd!9ru*x }G[UxȔV$![DcVEf8.ز1޴ ,&OLmCaeꝏ@ 8 X tSA' rb6p' 7, i  EbTQV&=/$O1BWhC D`<'@@&O eZ&suJ [z 9|@ kS}eDX\WjrJ!e@ErHAa wT%si!i"@T g` D @&ӄ :$]M %8$=9Q ACp $ 4$ uH ĒjQ ԒVC n ; w@B.@D@RpH BW ܠW?+)r!-F%CR W.luW*mܐW4/@*s *@@0↔9*``)C1I^Ɠ`U;Ќ>28t.hC!r8t \-Rl%eC Չ'GD ;Ϩ;DDqD}٧`F, -fwM# I) ?@C^(~%P}bR4/#8{5mh#<T'mM[ 'XyO t[X:d 0G} t tbuZ_PPobOGF$w>z{H/^q8^ ۠>L\j)F"13cl4JD5u:ַB HuSvgNXi]ܽfA$ f6H'g+Sz{PP onWgf]4$o-9[' {xNQf$ݒnT)@Jwx"箫 lmJ- kmMڊP EnE0ƹ,K sob,L}5:doCw 8$1t7]YHpcaQZ;+⒆:eB c5vc|[!0aS b]m"뇽Qi2 ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  ,pMx--t1l q9%`Q!D_@W\f\قzK; |d-r,(!l'42VÍc%ɐ#x{뻗 r33uݰ. =tFWwXPEC?؀` %Ѷ^sG<֨cHHȄ<|LX^4]Yn]aؠaf]Ţ[%yd*x:-#̀H't6kB;%[ StMX[C%/;uuA*x1$0(h &nGbZ@rMG8t~,ekoN¤ ZhVnet&8v5dd$SM :ru50 WQMuрIő9r CVwuU HL6WLCKwuvrB5 H9Yv;Aj7A d9y 0$jib QMhѸ~ U@cEp"CwOFCq |SL; xXQH@S8X :ya&"Y8UR|@twR`P5GRL(OPNa*šH B}Q~fxh +y]1&@;:I{. C2̬ tȠFfu v;@}{ ȲuR`*0}`8'L9'btB W,w3Ԋ(RH %"W(eƟ\;U`߷hO`çp+frlEMEmY=Ab[{.D]Rvtß[ "p3u*1D콰GFĦ^ك<<0Q,lD0t*h?%,Kno|U AASPkKJ:d` !?E0]հa3EBo9a}8s9,H5 7l'8'[*=H荥TV5rC&L3&gNJ 7@"}Fi g}g,2b Ȱb3F&.X#x5I ^lbY1ٲ>cVȡ~B>d3ۊS^4SD[~{κG*JX4 ᣁ7l6n;lܰ7ea7H  *5a7S \S7#-%eH8"b[u[fh4748N$Ai0*MiP@1((| l=D!d) )Eaj *XplQ daޘa0,IF'*1>a*1pP7,A>,,Q,d,S,!I,T4,2,n+m,)֦BE`B 5pE`E;B.?'EC/ppQC"E jv Y]^}K#.D]I+(\(, Er: Vgk*E,AsIU83EnEEފ!VSQ杻T|a [ꚆG_8a@x + =n@]&H *PV2P_d@5 ` aDM0&}!u K2 hd,<%Ⱦ8SƷ^@9̼,Ӷra u+^~\WҶI8 elyw/-u vUe۴3x`/+;ڼ* 2IIC;B [ "{"K@~=}EMDŽ}B6U[GC@V*\/NSRansE6CP!^$'W@'#Cu|q5~]0tUM)O$0>g A$0Hc/mFFvHGCC~m*_s4PuqX## MXWGı15yrKP&k ^uhC@Fv@f(K%cU]mXF6C."ZI$7 2L! #Td2$w¢t7EoF2Ĕ0T Wk` @-Yg3H5H,oTI ma`nZQAC F2 Pi "DU5$B60_U``REɑ+/prƱA6zpWrtjS)t rDiL;ÙB{sF紃*V-õ1@n]33Tǔyµ#v,Vʹ.ꔜzPl!Z+-+4H,Ǯ7PdYVI0',kD1+e<32 p<'*t)  9F U2ЈiW01@!yv%V΀ 7PoGY;GYr^؟4I3W@$aу -=OnYV!dPM@,1V jV#Q;t3Wx0?0W@VW;S_ aW5e+SoQ+ 2D2B;ӈr@;Fʭ! %l b!@>N,A0w4 kG&fH(&!L p!=^B Eֳ َL)`c ! n4j /4::Hf&@-آhXxH*i䍖iKHQyi  HGE7u0( P+&4 Vgy bO y6 dmmz31]A@X 閖6[Xmh\ 6FZUvB_GBLF+ Ixk/$l8@Z$0)Xm 0_e/KW* }z( G WS*aX24˜QB= nld M $<[J 4L!a& oN cu %8^lt x`>8tX40.aեtv.X՛]^[wwАTЋ &6fnЪ P% 0/@UPp%paa4jF+: (4 ;SKCè MZM$:5W+t1h 2A rQ t+X ݔ\2F #!Dv @`/B&rA!lkm!A0! Jhy8gWu@ W m~=MkM6>|=.)]XAVKvi+rו6 xZYAVXFLTp)h,&m!Hd8B7BѦuI,Uj]"K=b^O CXEi#mASph^$ A ?th^$MuaZu9Ń^*1"0B(6jt!|A=daE{7QWJW' G:CNX;ڪyTKm]%_ @=qlk~ Lh`_QG.8 L6́; й!8&6:cԖwPR,P~UjP Kh$QRK%% 9U^Z҂+$`+8gf#5&kВ( HXJX cJƺ6Yl bAy$BBHL>X@U4bk.(G@@p13$ d@ĕ)d8lxŠ2 a'Y(%^rdx"C~R4g=u]+ K*0APt,HQ2Sp )bZǓ@u).W>%Gʜ0F`4,cdƋ%=JH qR]cT%a&Adå냁P@W ݒ뢶6ʅɓa W,$9(&'!*^[DyZ2o .up!NZ oC@A5"^AN,v齷8[(Ad!`88PNL=h}SAHpC 6u'GaTH L,4 a U -kdౝ-j%z9'^:,J/}͈^@f BD@>$H^&I@G`$lp}t?xSIs ry͈f g61[#M[9Km s r$<< dM($ ILJ6ÌyCn!mH^},!.tId+Tz Wg| -䙑}~`a"`0xA ԑ Q'!(PxàK% 82  w6Ǒ~Ffm / Nhy$ 8_]dr8&8o0 4''HL MKPk00IRT0n,ܺ;IVe`@\I aCPe$`o*a`t|+CáLL8 X6 M&! 'qtkYWb O t Wdyx61P(MN9y; PMǹ͓AnoX,k^vyL:.XANd <   h $uFpldh2hH3Hd`@HE0 ]$ ]ŕW PLFX4  `bբ@AJ7:!O0? KԳyHH*"S!O O#Ƀm7PoaEE9[%p%HU BT4 Qi0'@.y)@w9 dLB@Pu «9K}R)&p5)pvن\ [i` H%"k8nA1L=tF !aIWWJAZIUۗumzݜ&j.;n!r=U2TvGwk@_7!Yp8*%! ?CIMfIJ:4f :~FZSbHX.3PF,8#aI*fJ4Yn- {6!% 0`mUY4̀KQfZ %+54֎-\ 60W<@f1pC ){qUcmRP䀦 0m5 b%~8;i_q$kɐvatK.b  5AW.#tP]M( y&<4NLP3{) MdHJ٥AC5Xu:eQ72#Cvۋr'_]4kH j5&(%@5`6izIQ0ؾF0EJIUʉZ%jZIICQ%d 웖\ ) zXxXK qNi[̐uwS@0бB÷CWɬ}juE3rAfxV0Pm796y3FvD VCbQ_&nZЂ0J pU"ɐ @T!45p Im۰)`x8NqWxg` CzɪnM ]!O4|^! h6j(3"IKt(IdJR(9妰(q m ÛRꀤ5-W͖FjZ{e#{5֔B00Xu,8$ujSp0Ӯ%,D *S, \۷5A$]!Ą=]46zLEayӧ)p\I&BVx$t18L&Q:U+UCppGx[S[bH6MiKhC45big+x.rp0Kt {|YL);u8k„Q1)kBpMd|SLS/6\ Cb$_RXބ[q~ipx`c4)dA =!4 {qI %YUCMcqBK4X7 7-$+b4E + zX ! !j*RxUGӸ]%Y5a`$lJ04: N Q)Uj!N^VIci aA4,L^<bR4Opr$g `PeI JOKKdW!%]ڠ,W'-q4DնEVdiW,Ȥ$M=H x;ՎZ!Y6Q2IG!u(S:TX ۢ{2j'HE@$ kh0, !IE>,'LּMV; Yiڟy8%2!' o2! cڊg\ Ä}%ЖaՉ04Qh`RыRP8Z44mϜ7ᜉ]{y ` {@X@xH%CUU 9/@ Z/"^LM_WxN0 ԒasS=Ye+VY^aVEܽF  D{^A".r!Wi|l+V2@SBVƤV8&5S lg@_[0P 1NVJ\׉lbIFą|bP+$HERxUC;@?R<;ӗIHHx bRE%,g uvg ϔ;:Lؠ2Q9Bf4RKpdYHS0-V'lKIwlMBO>ξA@SbSkIe57ǒ-Ok޵%66 C11hHs,7+u5h6ތSd8L鼥!駬01k*)u*L;4 q$Ɣ.@~Su2P Ϟy̪YpY,KQS U*PS!Z/Dc2[ ;+  !(f9 n-j@p*7AdJ&R``R@0IζX%n-P"p-e'd` \St DV` !#Ӹ‹Ȥ"M+[ PLD.1UTNf G؞B `7CGS}R'C&գ *3(Ȍ UXphqBRt޻%]Hj$ ]a%,((W# |A" 6ml̿tMI{^18}.^c-PEz0'$غsҩjyGj-[{+ʐg6 %-$䙤a+P*7? h;Z=50u4J%i{†p8 o:lt)V@J@iߘS]NeĢ;P F]$|斅\@l`r2@HF E8O[2"p54FA;Xc<8L 03LV5!DGF+TcTP 3f kQ |#WT͝S&H֕|RCS\0YM# /*)ϴܛa* pi1;d Ԯ2!}h2!2M&;;XTS-$KM1!# ZLJQ\,!UHh'0\[)AkY+VBX4nK([IiOLtx{  A4 IX@Fia C]B@P+V  Z( baXJO풣.fxM `K2 u3.3=Lhp;0D#![A+#(`(誁4XZaDIU p 'PP2v} S@PKUg DAX!Ђ79^tE]GEBa SSlxiAF $%MtxJBpWO%RhpJtW<(j5Cy&2U3.,pd*h7KBc Vm "}pp* B$7k!=!HAS x*:jQ(hGFl |zSt9%Y)ܦ3;SVP⋑a'r.)CG6yWaaⓉ8Oy7yX : $ttEqxZLV[nxWvMVnB5|%S }&6;u -z1r , OC.AX;^/PHؽ u%F < :$%R r7FjEjSDCK ]GT5TU2yi(m$u9)< †P6pn=EBEVmc[X$W!CvuA(H|v Ѝ_$Sw-p܀wՋ6S\)^jkW6vCmA阸#^ȉQcL٨qP!ziK( WS%K&mT`ۏd(2uH@8:!]X]M-TD{gNW8B DPdbDZ ZB2AvE2(Fk?$%/:\[)!`[n&H4ځS]eM<lYe9Q@Q$hw{55nQƲo5A]L]!.Jh` Tmc0u29pu-x2$u na&D"5L F 8$PM)mK\YlaRߪx } |;Efv8t6V#4ԶÉИ@.ԝ>pQd<.$kE#B2qa%"U C2L)\ W#,eHy@dh ']\W]{"G;ɉG;`Q E'jR#rص ̷A.0B"D+qACj璘h[#CȐL y  C p簖t\ȫê{\7ɴ\aAQ:%d&NX^>NmS9]@222[ plh2222d`\X2222HD0,2222($T2222 222248<@2222LPt2222222222222222222222222222|'M;xԆ$%L=:QhRJs:O`l3I/?/6%jO `qY_T@Jofj h蹔%llBd_v5Q0aWuL]h}\n[q'LQP1H"Ҩ{ LˇTeo֥Z_Ub8<\ij$WY- 0ψ0#U=cR $mȥ%`,Li 8 Xϲ@ 褋peUa&"6!:ܐIdB܃g l^PV)έdQ)$) )!)s^uв8)IbÐ[BQ*T `bD8z4+_On Zu56efDT:]HcϓG=%| >  j\9إ%㹫,+ m)|)VlZCg;h?!}{UG PtP`MۆιR;dNRF ^ ᡬ/ Q52%j!3[G7=:][z)ȴ|n&TVBv9y(YWFmDW'ftq O&l_vj ackoiՄ F$\pMjUMEnPw?HWvWp{q ~Q0BWoiK1S[ok$G0#2ȴ$Qr~Q^xm3:-H.mBY,LjW.M/A:YJZ4:yN&%WFL[Db+`JzD+){cuF!LVip}I!O̅AueI 9U` s A P"EG"VD^@Ń4I,HT(/rEssmSW&t5ax$?,F=@Uȹ: o@ntd|GCE1 [0S;RMd^S,3!eHq6r9mI,L~k [p1k$^|1_Xm29HR2Y$E @AXi`I;!f2c,&PW${_dp9L:22!E]-ǰZd[k\tyJ MCt ݰ2~bMm-0Žx %  ou} ы\EMLSM. ݎUHh0Q&e NvmJztS` ^n@p;P[ u%]"g($ )ۊt=0y$ # tU SX:g?v6F 0T oG;>r Dmbn&AX@ 1P `Tb]7 9@~bqYwN^ _doBI4f@Lai Dך4$f#\K'T&BaDR`PA3 Aaj,7ESQ,#auk6edRzbCĀwéM Hs(i@b $uU꧲INtKeiii$U8<~ ,%W`GA,6@]j ]zu uFlwJe$-|!Fy*G qD?n#7sA5҈VCK0$m443)cL4AS,N10 K 7pfJgi_ZklVpT9;)ZG0$XzIMlji\bY2M&SA[R Ή}$O;›0Sd2-9]vAWcD,KY$Dž$]([[YwfHa0 Ih FNNBv W +g;Sa:"RtG!Qҋ\=(iSYZbU HH|HF^Ɨ8cSd0EEHSJLj5Gݗ'c?`]9+QuAu|uT`K'i$S*~m`8 PX!E+LQ8V+63B 3 sQ+\J%Yn*Md~z7 AS[P[5߄uZ?k a>5, AF3`,u'z@RW)A%'Y\A螤3-Q<=u_L#f؁;d/ŒPPhRICd߲4t,jKLUN7X*+#0eje9WAIQ>` !!@_kixP[ۓ.,Jj@ct;n/ X`HrB4ŏaV7Vj 'o{!I6"Hc, JF4 }6(7V6MQ HF&ƨ/LuVmL| AClOoHX1eQӷ2& (6# 05Q٪-(/ۗ&o7V;TRf6&A!M-L0 L:`B݇!nncLLt"ڝӃ m":M[=碀`HkOCRY䫞QBH0*AHi/-Ē Asz#6F)ȫgyC)Ԓas?:Tȁu{ץ T䄬ХL%؞mgJƁBduIxQXJKbf7Z<0;R}$>%#t3 JDU=*P%s/"rWJ_;炴C'Jʄΰ(B/0pk~ D ֥F]{Q[%o!ؕu~ZL-{ \mbFgؕOaZ+Zׄ7MLi/YI;a[DxW6ikC~'i X݀bǠgGː8Vxyؒ:!ژih5ejie%GH|)HšuP*$l7s WpIYo!.98 ]%%gIIRG+/u,'fiMA 4C 71u_SA] __ [vd9&j&vZb#hD3!L^u"eB1(/>+P׊  `A< Cx F<R)I-]WX.RK;$\o3TI!S<VJ΀Wk/v9P4mI PxM[l^.v :݊H@ "3:b2&Ƀ0΍4}H^Ӿ:t9M>;HfG9L{1&\AE}2Sx;PXXv.Y4x b@@ ӭa*a?Ugt0 hNnSP %S{6u dOq!d-Wz2+q> !Ha#w|!<z Ngԝ/Gh/Q!)C<M%u) Υi NHHwwuj]A\:"-BjGJ g I1In:"j 5uYc[~pvO֑lTt) /X s="=PV(Ԓ-81tK9JVU|\ }_8,==0y#pԔ ^ d hHȡk# ?btg6q2ᴰ9=k#,^OtqE g}!R{"kRwx(qǬؾp;5K!ș&…78}x&, u2u*wVrq?[YtG-T7 ^?<,1"uWk- 5x"O )ъL0`1TBXm2qA^],XedӇ(m 6c2[f_Wn~u;@|t'X8%vE =q :Ea O֪.Lͩ35 VM `Pc' XW9$lRYPF7JZlv'YUA;ю0)2,k9`CQ]saa{/G*fJE NZ]>:hpߡĀ W{`k&H丈W%j40nbYy sZTqI8x;+;Or fF_/ȅkhMx_V lK>)Bwxg p WZ+-U܇ `Y'Α)APx #pRP@;]|@F9#r9]TN3\RPO_,Q@Bϔk6SsKM\o ;Ϸ.G WK6>(X⇚1 I<\?x0x+=#x0uJȍ 3ɧ;6 &c-7Dž+CXSUj T3I;mB64}۲]wsk_xXim5Jer][e:><|8 2AQ$Yjz~=.SWJKŹv()At".//LJΈ6BR9< 0>WMDHtLxƖ e34} puwG[7V;: jOR,I 47WO Tt%VPh[&DuyU{QA8/`2+ޢpgt^K(+BF[H^+ Az0oͧ^lkʵĹ[OC4"=D@`QdʆƸ MPK K$hAu!J 5K|7xd,B9xbHDh: I uTu6S")xg~+֞aw\$a/H1v=Dڋ(V5  ȣH6Lx<Vܮ_s n+S1M5&nmA@b[ WQAcZ~@27BsˁψW#Ϗ ;'xj-K#Бi A V ʽ -55#i# UCp/ G @ #JeOčνE -(## -|w]#g웎}c9*ƇG` 0 #`ԫ^n ܽUoЍ/+o'-n Yq:F.l! mAfyؘi-mD4#J# 6[r0SH_ߑ# ͻO\ Ü7 "k*D CUFM80(oq` +\lU`TuLU/CyL +щoU @W#8!I\ >?߇#NE=b%N  ؼ;;, #ÿx8$ Ћ@@+X +9XXHQZ^& H[DуǶvD*C̙̈]/bQFB9EFMTђ /OSDJ'X-钿Q=PС- 'j]J]LE%aQ566^?Ύ !1E+2/G|o7E, Jϛekć *,iHR!D:ZE1!څo.lQœ.㩑`98!l4Ī]LUËǒ DG K\ogo͛L*{xO33ڜ;B9q1Gç:qo334ߟq 3Z~3Ǒ"am7}t 3%@ 8W9IsmΛ=9{D꾤?5k337_ȩK a333]`y_`K/[1}n:pKǻ qu5Y~(rp']`%0oMp&:5[059ԗ7W\|WqK3(6XeV؇z8D")1<Ë [*C ~jZP#cyMUQ9VP+6oY[e>:;m ? b2hӇgӷ;̛]A;ff:O~o^1;:,{0{j@?jCN^ɛ Ȃ~S>D5:& & ^W*/>Nܫӆ FFDq]\Y2C>v>TW+9B^+x۞I2p -$?})pkrd]!CHC7ϲsANuECgv&?v\Sъjf snʃ_[CN Thb`+6NxC@Pu?nML\ws@0hGa!UCAo&i #Y_P6\c/ 7<qC8!Yv%K8@;%rI~ a 3, U`N=  T,&V"-1'$ S*–bYLM 8á Ƅpk@ف`q"ã.2p!xt r$Oۊ By50| 9AF;Ľ݄f+ 8Ϡ#k*肔{VhŽA+sG>VV`f , B)DqECęk^uL@m$nE H%[ LڄuW 87G- "@ G O$9G@_}c$(%\9%c@uC XS7Q㿣0Y0DD;"%b O,,c)r  o&8GL! łgy V,&&;MGHDiA& švA[:"jG1 | 7¿WG 2eG;g◾Qr9d.?,vN;VERf2]!ˀ n߽b*˙r.?AoƈRZQA ~J' ƘOK Ol_ԭ@"s\6uV0b*SNa>tI=MbZlu Z00Je2' 6t?Jq؀@_S}jl"H tK}@ِeauYԎ3sCu3Ie).SPZ:K3O%Wc Me4Pj;2"*JMIK܋FL` E GP5{I詍 d ]|\#E`#M`Q܎W%5(d"tf7\P/8]d& T.qt> SIۓ }=L'X4$ˋU0 m8i;b"Bl`{=Hꊙl0Ȱ%ނqLVh\,$rc\eSw%}4W`akr ڵ@ /K.ԐgH˻1L֖T@ĨhSkEë|".˴0^j#,S!d eT[T@"feEԖ`SS0Qcu9 Ldt6UU`H딼t$^j4c4Zvq<z !:EKh2Hj^601c. ~0pM-|F"ޝ$9@ݼZaX0VEZ`[̓s4oXWtf80M չ20uScE}wL0dSnٝTSqA#uzd4`jIRηFم((U +( ;GUSRP3,W# 7@`Z>5A648+i i؀lJFR ǛiIWQYUgZu~r.vt R fR xI  %+3j#.Z=""gD- t1Jp lr(b5=.0nPfuGwkPxh3 4V"ʝY7* Y MnY £IcɵJD.èQh0V() ui&C`SK$#.XV{ZPЂY٭B+`$IyTaSԋta"qzu 83 vQD M:I䔥fa7MnGEg`6neF +E=Ȁ2p  RE\Adll` ˔"}a4iu 1lcnJAo/@o +o PAnJC(VM?L<=:aP,K4 x#@R0m:hX:ܼ?ҍUBhtIUϫ4unۋt1f?'S24 Ȱu gvM/&D ۋڄR,iLL~dcV$J!Ji $ʓ?'t,"AǁH"%UP [Y%:@ FYxxJW>!// ;c96Np_ùENIgʍ:6 .E lkV! >3 '$ a*pHl)ӎV\L~.%v& nDPOlD604 q% `uAX3v5tAa%|y% 3*Ecc rА= U VzU $ `PEP Ravk02&TZIñ ۳ߠFXgvK+ /u1*HgH8=EJV`db JJX=H",w^}9KF5pR݅8(a>V` "vQ[<\E >xJ$)/tI'al܁>*6$6pFSccbB<8\x64deW)%8,DX-  iWeoRw0܀QY8i Q̋@ ) O!ßxR+92GE tWx^Ԩem[Y`}3i L 8 b@kD( G E(+Q6ƯD@%SQP5a)j*IS-QQlY}WH =MFI- $( ,#5 iB"c(cxmh!d Aj3` rnaol^%s"S%°_o:SA X@lz1KG -4["` 8+zIM#U,( P\aoNhI/ OIY`;xq/|ܒ`s1c$d4pbk Hдˣ')E,w ((|!qb6°P`q#^ ߴW6vb5z2OZBM;Z%c4F$ vmZGWSIZMx8%VPEh8\M x' *bT^m'P%+DkL<+C@>bF!f;\ CV@R {YH i& +VLPMDrQ 1Pav!2n\8i@8)2oSl Y!55tA ;=RA"|&-K820>"N(Y[BiA&Y%XVIk('ip`k4 UHk kIE(k'ikN@jU`&`LFUmTK?' ^2נ٪*m^ 8CRu&HЧEp#',VI'!ơgK_<ńVb5mD1E`ߵpo’ZƛдN@`HC9 40HYPl ~¨6SK 40=HP#&Qƪ -]0(pM&pi^VuXQ3 !i/. RlF &ȩ J#k $uZՠq(MUM5 u@#bN <B Y>tHHu&jAXlv}U t8B܋V<<Is<9/tU B3uW^@+@!eVSCyj$Lr@xt0yW־@2UNt})ep9jUAdžR~",X%CQ9<'@M|`KHQRV77AI }Bj 1 XC`C;`K%AYA8X|(OB`JZ | A.A$eQ[hpޠt[&Ԙ0 vSB`--&XWn;#ѰջvG{\pnZiPY!LN"&}z1Ȁd &KHpd@( <v/Ȁ12[Q}9 uw"; i`$(i%;3i;PP tjȣPVHWLCi (@/CI ]31`V}$EcpPg`[,"+B`,x- K^vi( WTeÚt(9=7AWWe#3W LAi_Gh5 e:,9g2oBd!CUT%bCSkXXx F$`8"iKWmԩ΀$~8%K! b"]λ (&e[e׈ia!L)5.ucA| VVLY'B֪\1 XYU!gPp16$s;A>R(k.d=Ѕy[ SD'A -Y0R5ǬbXs,;s0tt( ,'e`7q1a*e9!dV1Dn&pȄo@ʷbf l08u SjrYh 4%%(w12AV;"Ao!X+FE= w<%ONAigNLGB 'LA*+kþL6C ȞR LS)lm c:!P;AFdBWKW1!zu# ԯ01"̹$QV2EQx X 9t9[LQ ] .AXGGѰ6b)؋q"6AoEoaӷ!&R8Kta} La +8Id ab[/QV:X ! 8~Ƴ`m8@p3mi i`DkXRɣh<(`4{5PD{QԽb! -@ւ!2Q:E-\+@tO $[sF_aPʍ9˙yW@Xx eL+QQ~w~VOu% <@Ul- qÓ {pʁYS%A\R$a ыU;Bvae}GsU+ w9AwLrEgر)ZW\g)?aI(b")!S>4 +|7]V+AQU'H)VJ_B@YFB V s - :8+Y8`:J@lB> 夹dJBq4W :0d肍"` \[ 邍gd85 K/( V0@tQ( CpQF$[5T߿3% 182 888X!W8%FIL 188L 8K:0R18\!3%188J䀙18;88EmB1882!ϔ188L bV184\%3%18S.mJ119̔ߜ1L ٢1C"p8!'+"'YJRDmB%xԅskGWj$"Q^i a$<] ,V P43A=>EBAH4{1`D,m6Xi) daQ@6fWk5wf<X7U5#Nsu_H6j;rF>P4vZ'wRH Tԅ ȅQwm5 2@= O!B!X\ SwY ;ךmd4_\0iY]n  e<kjBklqj8mbH2+8㰿d G*)wlE5K+88$v*Fvi9x )AY;2NȉvHuy*WBcc''C*%Yieg-62K]JˀN$Y |+*s=R;84YKx 2a+ pl\@vf(a[)ML_Y HÐC*ۏ;1c;@1=R@|.ےV P;'N c7*Y(  SР , 8kx;H„v뮚]UVt@3RDA{L*Y?)wOAe@uK~Ѓ3[w tAV2#;[{ Ak$[,,Q= [2-΅ G,N- /sO=4,tg""KZ: ׃ :uRFGHt8uE=>-Wy}0C t+ N3WJ8-2_i;8u8 e ;iH$GQ& ,${}&MXNk+U2 (H9(Fa zU7tnY-, 1Cyd,;%].m,[py+%ʼnmǵ0sW$1~BB#v;+%)DHq@)$!Ǻ8r 6v/=ؐ\&@#{QG If;ǹ,,IWK^MGFBG~M@ L44M~D4M|2MAv8eX6 h^-l_Ð:Cb#F1Wt1|9$K !`rv!Z{{r+ hC`x׾kuNOc?Gm@wROP^*nHW[c\i $,h4 iZpxb[\`'olj$\`rW!&:d;#&&Yy؃  tdG]I݄iӋ^4nܮq_f+_y##մ]_# Lp __-qK_ iiļ0_4m0r_%%@i$Cp]_S_6FS_4MZDLT\d\Mlt_Ma>3@\_IO)I|!xe4|HZ$Qe@PPjQ0D,0-Q#C]و~j.\UDA܊AW+XG+7,-+u3iLJ "r{ ypf\F`σl9aLn, ,BPFu0_} ](xih { VY !'=##u(޿opWt9 lfj9YV `6Vj Ƶ; dW~B<pIDA&tF-F {I(JR) uf=ar] z'wW5AV-VX)׍daIQj)W+lRr@,m˃Ff =l%T0N7s^Ax1,hf |3B] Jeme)Pt k$TH҈6Bf8h;=k,Yma@VPWK/*8QbTL~uS3Px(Ў7*ޥ@S$PJ |AOd Hm5i 8%fw"$'|yZ=޷ `4L7C`;h`A2K%&_ %>(Tr;Nwr;VvNO[^_k u 1vY1fJɀ3>utF%dQ:Nu9M`UF% 8N搀+@_.~1opY/AAf T#Ep*Džc̈ϫ5J ie, :=?V^rPъYD(/AkhVK?Mt@- ׼e0Ni<- t?V+Y8t3;w/Nk+'ұ 8 Ö8 8< J5] jvEʴWOuH[E)X ? 8P|bsVkUYb :l_EitGA2, O:! g} J/Jє} Jz9_] 6*|}w7Q(7Ѐ-{jM+.$X8=SR@$wuH:$]0Q 2WtaxX$OϿK!yK/n Uw; WUW.#TJP-'ꕘg7%s6`k;r;v º:˄M7x =^N؅KuE/\>jTXw B,9ƭv'v_"|?"*@X$Bq#Tj1,a\؄ 8tW zV0x 1uo!xFt%)?; !:QeA`:/KuòpgttN%"tl0];pUKkH?>H~)̲婱Igd| Q o7҉ 1҇& "`b+ 2 9 {vNEfə`.7WPG&irw!K,x8= Tqbߥ/XThJ%@xVC20XCd&00m<锄@ %&E.KCCs{/a v|EVUko ]^ k`C3xj]-WjqUx)AP0FPIw x#Rv6N ՇW]iqق݈O2F82$-uHEuY_ ύ~a(!8uĊAbf,vo t_hЖ{i + 5 S@e99G@: Op q{'_){ N-*F3 #_w0ˢ D#_Hu[]N 3˿CσO>kSJV#2t 30_B{ _ h~ ZE9>tcf,oV%ui 2EQCVXP8csmOJ xv']A'^JU$R$a%~ѕ/5"l $@\: D1/ Sk%XcA|SRVKZע3ub9~u]zKxl&ߺpl@p'@IRf΢âZ ;ہ}B 3`}HWt `)hփ`;|;{ ]C z-<~d7x~"~s7%BUc&9=E e$ Si.h,!X,H/P\7^A8N|C;>"'Het@QHa6?멫z @xPtA0 C\>RP"9^tI# Z/ A24tsI 2U;~;wJGUH hSH=HG6;{1l4@ݴ릉;«67itRF1uz6UpW}Ebʸ=,uWn ,]6H/#W-A}C!(@s f;DEJ0WP~z]8dRAzP=~FoyMAlpxM8|MpuQSA{p+@7kE`+ZxWԪpBMqYn,밁9?5~P)#bc`~t:V2 ;(WunTwrx 0$w簤qHϼQyuk)=`U|ADx3` /YL0=W"pFtZArMM7!/DOWR:s][8d1نL0.WM^DV${Lu:`;;t~f8PN;fstVkH! ;6 XbDb3"tTm-V?Nj]&]OS^C]Y.%cO8Et:@ )^Lt/ .jJ[ϡd v^){4 s@PgA熅-g(80?AJ&pLcW%h+%׶ PtlW$< y95(0 8@D P=!`8A:;9p`tsmu`6 sڪ׀oJڢ.cKRV"z1F`f@)f󪌙 zoȨVdj ՛ |eLW$%AJuX=ƓFXtD u<"2J[;A~oHEs^.ܞJ/ A[[_)fgn՜Q%,#j ڂ;s {DG(RBՂ xNm;SBY${Bs}܃Z}`e|);ՇxB!wLVJs'5C:B8ܯ?HS;ƝL=IƤ8,ޥkW/uK>`l  I#)iM5u"Sa9(,OTVv) ЅBbooC|wv { W44~S30 B FP(Ss\.,zF|OBpОS ~*x;t˄rtHY=F>:{i68_5x~f+|) $^_<:u. Y:ak % tW:AmdT(;j5uҋg@B,%hlX: D&50u%\!ąԍ.DCПeN>( *t2 FtT_ Lu7E6u,z 4F#{6qE/?"mhtlwtߣgvMM}DeIW >uOjmB Hq} ]S c,dlm.jg~8 i.5W$v" [ jdGϴދ-A~*d ܶ.V|(OPIF8݈ufQ\E6H{RF؃0eM x Em3$OveIX + FMW ҍV )fX& >bI Bzv?MO /~UfP}G 't-ݵj~CjJ$DW:RЭ{l"C!Fխ;M'?WR8u Gπ?^[aM㎓!b"ػ1o[kOE 3x8t/Xt*xpojo^X\uskj0[*vًjxhЉN+YE{3J]u ]GUt;Uˊ<]t_G<f#SuM46nuD;V,0#Kf/-4h8W- qx±V~"[a>i_ahJx A f4ѡS c8[N5x EW0h͆sw m@#SAϲ<|VI^eO_  $'0 QĚƶ #]6^i@FcGw$;5E^0*<$ f "^<{it8u ) FYfOWtwgP>+ޣaI}D7FoÚ@I<}U 2Sab` ]oRtPCD6}2D÷)Zc:H|cYuUG%AJt3H*,8)g0Œ$̸kI' jd#Z>n0H IA<[PY-4 d(0tǹ  M3i &`ZjkltQ F"ɂ'Td"< a(tٽnMId.XzA]'30¾4HCfRqۄ5/6 kf f1N Շ}@x ӿt uevܵYAzt! @*7}/w%AqoO32G| |}s~ҥҋŋud} X$ ǭ;z2mKzF5w( LuÉGM/܃9~))vm뵠+J\190N H@04/å&-+ A  w 1 q.Q}eX3="P*2 tY|c0o2Acd ~%!UCv!fC~2v.vO J;KaĀEM~r _gvL45&6~ 9'xO+Bh00dBu΅_`?]>=S~!eVM}sIHރ>AZ`ƋKqb&x%CWFjPmDݙ?OlC;YAQf2G)3BZigFVVŔTb|HMAr;| u(F"A$b$7>}N>-H-<~lg[:[]62;{6V: 1oʺh Vah @*K #X9a & 3dCҸ' `%0GK(VԲRj&0Ypt`WS ;q#t7SbTpF")#g0HekT +SVJ׃ 7^u+BY[5fW4!q$A\CH#8[$] 9(?kN esSd#ia (8MZH<(1H@21^,pWB[@ ]-x@HbAl@kihœش&"@8 tDYa|!,"fo A8uj}轍e 3IdPHݟ$ 4PP$\7>}q;#wYt058|+9;wj S B Ψӫhj}x ##%ttt xņdt6b?ٗhu hjY  av+,)[@g`VzWuf:#X-H~%\^  { j+ջC;:|'\7]['$"IO asA7WhoH \um%T XK6P`@HlX  |>U~+P r̠N2ь0$P@I#;&~+y i@`tpIEdO_011*Vm;]~u?CJ?vj?Z;KouL sL!\}tD u!y!͞]A=Bx=YmHS[IwZ-y"lLR.]9h`,+u"54G K^wWޏ+цp;"9h;tcq{q?ry@!tr{A|Lu&21#K= n,9o>s2Rv`Nnƒ]a鋋d\yxgg'^bQ\o  hu`>i؂#s%liX 05D[ )IGJ6pq N*D0C#CGccL(4W X?ev?,{ Ps@دHCyC`e#inC%pm%J\ J1@6Q]L  H#u{K ^;Dta+]V(d=LT))2aW}!\vthehPsD;#W# u v%Bv0ruy icJL9}3uYHs{~v<&n& 6_Vq{ xPm wr:YChOxQ8FQ J)-OO[ĪD7%p#UHD ,+85#9 t鋙hz;Lu j _|BG@T +j<N?~Il]+t:JCJa +U8FHl\D2^u8I! WO)W h+= SlZ-1Y c=zsgyE{ՃR|~KEQWCQB ;dX, })?""ſa ;؃i |]/Qpe NAR{bCK[, 7} <fmEА$2>j؍y>uTu;xC MƍB @H*m0P Mt!5{3_\hAI(oa4gL N*j }3W3 vHb~Ńŷ6PGJgFq'hv Coi@Z04-@J?4< y B0M*#NspYwU OI;q>W\9?,b_O!alSE84?vXY__HH s /G+W$/C<]{!Oo + qp`7!'4;=O1/6_> h[ eYKYKYY\y]cs!M Oτ{;q#%@Os,o**Dw2pL ݓKB!)8,Lv#v&ꫲC)FKm\3BHxi!^w5v61j[uw.Ljt04NY.wq:H.w5p8{ɦW\ qZ\Ұ9!RyP,,N8%8E h >o@RՋJ# 3PO"r -kevOţ5Ħu3c N6 3҃J#JEc& MP|W%APֵ%sӗ/1ǁ.h 'p` \XjYBh׸ae9+0퀣ϐ[`I^! 2 2ƳY`?g?S@ru9As |4x} w |R_ ^6$D Et,R@*ބyXcmZ B| iwoY;It ' ;Av c;d 7w?Α;r Gf{2+4!{Ix£+H> - ,7W!K!8M,/ʲD5 wqņU6WV(fP,X +V2޳[&t7s:|3~vSL{+asu-ǃe`or Ja~0s3Eb|D&wx{@Ȥ3rҋ6;8'mty1)i;#{&/Ah!u =?m_,w⎑;} + >t拉 ; VpD$MuVM!~e PP0LmX\6A8;7,օ-Vlmo%,98DюG Fc))IqzA4t)Y1T㉳+ӧqC)Pfi"^ !h4=SĿisC07vX^;CFsNkCmCUoi)~zuw;^Xsvu@^X%C@2Pc -+W1q1TMs)ErNޏo hAU kG'dX@c& MG |/v+Ȉ~q`se&&grU s ~FuBBEiw+} 'Ws'38@<vCTcC+06Z Bb<&@с VSQVfx*Mנ ,_ES_r;xwI-]<\>0 `caaYDu#%(d#$L+_b!rHM&_#6C`amvɟaQ,r5 au%ycbt< ~WIhv%ye= w8 #` Y0@4u AbCKཫ'P`ŐA 9!1HsIpj} *! n@H0 yM BD Udb ei\eBAQx|3Ÿ@x߂-$|gBۂ3Xǝ^PB-OEt?+eq=G͞;~ ?T}"4 R)f]iOxPd"/t5IA;t.ض5,:/l!Ex绚p&M &a$LnIM$mO/NcOW 'Crբ<ψU$":10 a!CI6 &XaK<3 oYCa (iD/0~4b I8WKxEB<(IJ;MOK$<=9QU9 lvP+N}{&Wt<80u'qSu R8&0Xs…Y,˰E*-#+ N5 `  YXN;+u%rje d)dc .GN~A u]X WRÅpL35H}IC6m4qBq&Cm $L;)y~}*2"k}K%ZY="!pQO4 DoO\'Bڇ&"FFPo2MQ1LB/At!rH@I1L>NH41 %8f61$m>ΥbXn$ o jR(v.Gk]xSY tN@D &.&c"aB<#uE$eB ,D)ns9,*4ۯvYR]g\qE-$h*V%ie@#۩t_0B=̖V|(Z0j!f@Y\DG]{k ijKL҃8A>J2@*;1$4R( W(Pgc%+%;w'e@8@9AA>=r0Z]xJH 7vD0DRybG͕CeӹKvrSqWZ-st6X1tbއ=t\jg#Q;vˀZ  Pp%D)y)-3-! 0^"#JW +H7$% | W|?ې <˞ 'qs]5D+O>f;~o4S^@[+( E 7-U#3gWUA ٠BBB(o(g_[,QV,G;`V=VٕGMW `)\0p|tȈm.55 ޶〠8@I+6+Ar Ze}Ȁ ar zw; 8Xk^Ix[, >qjRu!lV4yYY E]/EuMm ෗4vlNN!%ɨhBPO&ZDĊFz9YO.1GIԊ0߇_ F FsuQ: ] e !qE#k$*1e!EHk{t8uHgc8rJXCQQ5qt%(4# 25ޖB %pЙ G+<㞀 P#-z)3%=mQ\t2֌^>IdpVK#{ N >0 6-NƷJ~P cp@uxM !Cb{EA=琟.==9=-XY_݀QFT T)3a<,92 (5ː˄ MPjN߳[QL5gBCG=UIXKuB!`!jI ʵ'm+CS@d+4i+k|YT waȚ_WSp3sv!ژTP;ԁp}(pSfH]k~QDJ I n Dd27H#2qݐ < P5%H O+H<L6 L !n RJF NiI>4nHf=l"#ְ8׈[-qm; v}$'R 2ws`*`@MMO$ mA|LH0 8Z2/ ?#:kQc cxFC-$v Gۃ<wxuM{_5I+X%HByW.< >VN6 am Cs8|>ie/J 2܁t76p,!{0 3# .ƐBja`nԕ2#7!y%Ƥeֆ OƟ@@u +ѸCa@G4;Y+še@#9U4Ђ$J酭O\[طS@0LK ct< +@ Ub 0uVC$uc *!haA@ez.TY+YkZ:h;܍&bRAr|%;435 - j܁M(Kt`/LݷP=%Bf]Qc` 3B8zAb0pBd~s)$   @OߍR+ʁ#-0;Z㉆@ApZ@JpPaN ܖ9XV%R wµf8M)UǶ.V>Av,xqhX]k VPtv72_WOZW= ZڿF V뮃F2 ecz{-^VS@'p6 7 V%;!Ym 2%xaޡlD~i8!UWttX  fi @3h|Ѿ^-BWt#ֽӼt`2&b< Q^t ;i;m_][v#V/7K  5rB˺ʾ8toU`  Wm YMW Nu  ^6H#AZȱ`) 7'AM'&ZL\?^}%9rLGn~ V+ @n#)e0K-0X+a x'W h;#Āj j ׄY,+ʂQ҅uF \}}9 |B5qcb efgj-uEYR7ZTNx6@)-.am2Ӥ _ &^gat+Z//!C-]# N`X?YVI!j=DȢ1xKѳOCiU wS704 Jaz |؈1D3J A!k`pQ}[] :+[+.!i)R =p ! ^ܽ@ [s|uDg? DyKy ;.GH FӋҀqH q/O?:yJi# @k368K&#*YN"+臽-Cq"C>E,+LQ}@-jJ fx 1h{57#%3+IAf)Wɩ}tJW$ 9Y`?mJ ~*H?0ً~@tYAGQ!0Zz;lOx]| Ç9>1BWWH^o{:uADډZS5$[G>ȲNHd6-lB!,ңRtP ̔W( ̡ tmx BS"N PgaIa òϗHWFIxPAJ<*WPWAb-?xؿB58X:#ZgGҏYSРЙ^ #yuD:1rS< 9l"XX/VX5, VT"-3uIX*ٌ.u7> 0@;}Ի(ZQPp [d7d=A;|a4sP GY6* Yp< J XʑrR-P)j7crWF&"rٮ5J>B67)< ƊB !@< RMֈ_S.~)fD0 -aփkRpJ,7*[j#7Y189m#XaG Z+gDUm0ݒoݰ;O $Nl,WE+_C;˓Ayg] ڷ~iC'I9qB@-0^ g CsVAp IdG= jJH[ i_ u&`s@ 8,h,YumCkޣ4~ 9DN5^v~!ġ#HQR> u+EoA =w3u&5 A|0jH@f:*,6뵷q^G dY860cӈ3uՀ,#oʊ5t gan%4AI61uJ@i!NYȗ2vhNVW-\MPSGn@#Y)Y(MA@FBL(:K\Yi?1pPwR?$1Mw\W%dկFr3Z}ʁ~BZ⍂VyDR?w:ѺLVN39? Ncv#n<9C99C H 2">04:hIKQM-em^h\eap\11[UmJ){%U #d~8%瀉&ngJ; 9Wz+e}+S{ܓCM쁮Kk,Cj1Qu7%5*=5AeyZTEY`K"5uo#},pLs y(|;\N M.n5I7wc[&Sx߯mЛ`636c}&o0d56 -`<% BA GTGwc'<̓)VYoEl@|u  8]db d t<餣iaU0p* V41 E;0GK+!2`N/MRD~ W4+`ʒF!0iKa[(Up$ ȁ$#% 3?i$UL$((H=6T$D8R$X;ƄMҖ<Ɂ`c%{tExjP]ֶ]PxA$04' 2DF-B|/>Q$R7 }%YH@ N#km[p݊&c40PS @ , Mjq,k(1BE<@Hr^eN VGPCyM$ AQKEͰ{U$(RWEP^wS H{jqvyaH`r$z0 o3+ʙ3 Q(O) n($CK}P+ǬQV0R G\"`ZuA]n_\DQD;:86NpN y"F9Xh  PZUG T8l $JF00;٧Ի!D6Rm P RvcH0yPblil ;dLQŷ W{W)WEf%'-1==DQh 3fQ^<8D t4V\- >crˁ=S=&5B/ YS\$R(daP AB߯ߪ0Y3~$EV~zTn{93 [$2iRRRckaxW>'!Qз|E#q};|) tXaHHkTώ0)8+pG]#p R pPKtLQ&PHrm eQ˸Vd<6Rˌ19aU?}nu=j:X=U;j B5A E@ C|wSߴuC|6Z2;ى:kb0̍D-]xLUU^@&{T (R5!={R!^Rdc 79Ztv(PDBb lqC q[!:AS4sAQt*8wŸHa@"=JH{LsN( W L Uגlq 2 p1XVO5PiÉdSyq #xs0Bm]~w 5+aoPX0n3 L(ILL.]بri.L߈h.یx i4 KJ %iSv@&#if'TmVcw {/@wSĞ{.vA /eK >tii%L!W&LK QDGEOOdAcWGj _Mo(J"j2ہ8'=+2RN89<!A` +Zp)0: t߂88V6"OW<+թ:t )+Et2n0O51t[7+?ApqĹg $E ͎ZSG_^]'o ={h~j HI =]xis|!0pZX Rр-kW\p}<\IQϩ# Yp @Xq0=3N†P sl{c}\``:d Q$VOYV :(x C̠`LEOl:@ڸKTќ F'Ӡ)2e6h "w0W6J\5%R/$Lr 28%,Q]Sݯ.qT<8(7E7Z*Vh1ıǽPp6Q &IOoKR'_N U7 &SHM'p_tpȏ ? T]W&x%o'jX*TOWU7ykЉQf WgӠWsT+Q[3}[a%w&$d*'Lª1UѮ.oC< &$;1njW(}ophNz(缪'&P_xpVw#10ZR.W(X TWէj7p6 )`Rr䟨׃Po :L{2_onwvȁW$wW$vXWwL2PHG B+t-)jŐ/u p>d؜:iw?SWa56SҠUcgŠ5o7\nO֟I4d {?B/L7dמ(my9u r`V7Of5Ѯ"`(ȍ _5HKP  :bmH ?{$ `҆ 8U v+`حj;+P% 5q=)蘒$w%hSqab[!CJ^{ј]%FUpX h78EfXQSn0A,X39ڤ@'QlA.@@ # ЕLkZ5dH&y 6h0|Q*w<iĶyMԣr-E8edEq >^]+dK{)F=Ĵ]/_ "3 nW/)4HW %"O W v%NMP[p)'j`w70q#CΟ"`N7*P H '7vDFhW϶lTݘ\Cv[`xoǒ x( w4Oc4N+n  ϑg7,jͲ'@Ew1IBL[1WiLs @&|K-TR3(U>k/D`[5׶U a-)m5 &ԯϱ+6.h3OEXkX/C6@)Y0^7xtIw0LMWg谼l5M)+ t m;A #{ffjQ[KTT}Pn;|g*[+')$w8b9"`6?ǀ$^K::8"wXEL_UhB^",a%؆;X(>(j–'7;4#S$ Ġg7>AwcD?Gm'`?#Ċ?J$ETuW1;G%p[#@6'V=eU;WA: QA8AiC0w7$vmU'_/x%Bp BJCB Wz C  CPb!|(EvۦZ5Uۣ).pD_wh+%ukAm-%T*EkEi5'd$0b5F((0R^6x U"e7G84DG>(yOy+4G&lc!6H.kHH@"qVQ~6&gu*IvjI{OI`,"JNˆIbIJaJ(56/uEJJ?lS.8Qhe1%)-fLDi|W yw$}lɴ.g@+p[wAK֩SOKߊr3ALkТ/LO1b'LuJ<+0O-=pO$d쩐MF y6_0ThoMCmbMD2pڑs\`NjwԽjO8O jO) P_HL1j,Te#USS',NTU'OFhǴN M>UUbh^i"ᦄ- yL+9: H p* \ <3@yP!2;zTXV'V.d'B&dBdB&d&dB&B&dBdB&d4$%T'GGs=KT֒VҕFc'<>X'WRIW 8w. S5XtEgHrdhq٬{P}&wیUMY?& Si<~ټ[D{VX-5E O/%FZ ToZ&HZ®p\"o()g(u]2HXJ3tFȆ :7 Qz܎0*Y[CCɵ| 5MK[ EU4Nӓ\h+;(4'[y\nɩ7]oy]@/c GȧX,M\B- ^)r-'hRѐ'@_V_80l_W# XpeW*HGQ š`% e7G`JuG/ !! Kk` paAW#u0jŌZUع¤hb\бԇ4} خ"i6RcoGP8u7d,6eAR7 v(?8@Ke3f Z7f7g.S䥶?/|^S(`PQ*֬  ɰA̔[q s$b&Lfk)J)Y$d@hAނ .i^CYW. 'FG®/v!9GTBj5Vb!:^oB.`W@(-_E+paLOH%U\!/47 8/&bWpb#enh.sJDH14#3$׮MAx`D;صi;LȰj?#լRt5Af Hm#" Y%L]rt$WF## M7"k747K+k\r@ȘA\2X(O ȌCFNK%g'E(:Ү_0.9X3 q;-`4v(cxha#L]+\r-P+(Ukm0.%`8pK@|cW3kLqj`c09 (H júuVp&oZOgI`ZGğ"W#ty/F&$nw'VK]6J* ϭh'@$Q/'h]]Đw_H *^Ǿ~R05GF,SlH$( R&_N'.I|ۊZRf]8A*fmE?D\G ذ;TaLx(7T*ɗmi'7ؘ'8'`-B&S k ^iGߙHp ^MWXQWDS8W[o2 $+(X $+2RǜH'xWo'f؝'w*(!Ogҵ)hͤI]6#Sj n~F rm[7WR`ޞ0'p\Ў'xO^?"6jVZK7B5n&(/OyX N&*$d` GQ&Ǵȡ0X.38-[˜o(硐mU&@8&F83@c$q#q٢Q? Hk5O^v)AmD%q1DkL-뢆KۃLuy,m$pذF4_0JK.v0 Р`iS:ΝwK&Hp`6'{&OVtU/mZl2'ͷ8w&AHE L2%/7PVf \,[W(~m< L:8]WsCP(Pϱ*Jm-iAF`Lg* ש($*g!a"TgXzN{_h7@ogx<ྡ?*TH0聯zL'GG-8 g'΅Mc>Јqk83_/H-?-S'Rq r@DV#> ˆ°FP/ !^ 8b&'J H p^2d@8`@+(4 PxĈCƠO $o7d y(XH@ H $x2H8hd % $(XT/ʈʰV7.؄!(RߤfP@JmPD˸)0Mޭ  $L.4W8<+N vPo5+uxk&8_JIG7e* T`#hȱO3lPS2@pkۺ_' 0KЊ e[X%E8$vb[+L)q!.{ 'p?(I{g*-#^& '(qjGP&xJ$&Р?VI2'0Ӻ~oWќA7XiAנѯ`ڒ'((ƫoP_? /cVx6!O;*z5ZucVHO >`GO:xӐCQ"ܝUFG 7 0FH &?R%'@^ Hk֏՗B7?+07gՈf>BG*KL_ )1h&!SָC֣‗#W@<jvpY +X&TN%)Npc+/,'D "OA$@ ,!K[*@.#uIu`BA!, %&2eéi|w) tX04{VFJ@]\vm!?GWڊ'sO,e%T|`EoԄL>6SJ.6"&KB&dB<d0E2DHcp[Ѯ2@8/DJL֮ئeXpH^B6yl:'u`@GRe6hת^6w7'_"7zH}Qx"p|hlD,,/A4&cKO'\l0& !'ajg2]tw!T&z<7MGޘ&H0џ} ;?TD4$ L caM <'B3/HXr&/qIinp4H(N#VK-GH$ ioo'^ S!u@*;GS7uIo'[4p=X@$NKUiiO4; I> q>He +I5S떓.+0--Q8`v}l+mKDAmQ}0W ejBA6_ ,Fc &!/ o=,_T`j'FlD1hAe1eHW5p@ tK찁 AdٙxuW( p7'(X!Q]ĀWMU OoJ~ '6ZBf?O*ֈ+ea%zp]]8Z!i-.F A(BS%*%5CwVH3]X!i]wSX'f!BI5ε!#DYQF Gv@XZ FWЅ|YdXjtY,`cBmuҴ`5p%/H'␟hws;5\Xi0\K(B;5CQ$+5mɗ'-;oV/x&w 6L )IHةj*!:ԸE C_ b÷vU/RFw' S_'0(nQ0v[r jǗnli^`;_څ`a ~ pm)U@ƕ\ h" U?,1GV<_b"GBȸ(Ā' .p/D&o !/bb47' /&h4-N yUĚTC5dhKA"Xrɵ5gt M`M'7 .N_ Wll' d]!'-y-8k0WGhƴgwDڴgWTD5ǴBFGjWlm[dJF0XB?G]ˁUh1 G]B%>V)K?bH\|v-ħX".BuGd 6,8 8w0.?F h(vvNW 22 5pÊW>I[*4TGCR:/')cWp7??37W, R/]7oKTOo_ LiHז8DŽ;c0B_4 ?Zr10L0F,P{CU\#/ P %2 X `E&7%W6XUW 74tk8[NGa@*cH`'D.lp؋%o 9[ p 'U nY]] 8-_,7,5:]n:0 $$i0 \)ȧ!F"0bZL!Kolx8EW<&B="iߐNhip\4,j@iyUmå~7G%1#'hڦ6 )#֖OF$aGg^d\8X+IOVpaVO`-/&'3cV7%/oW6P$`? FWiu=%m#V[gGF&.]-iG]Ko't&BB&-hwmP ; gg&-%W'`jL*TA(ҥOIqe&Z4(OK,(QAC u>JCDNjQK4Zh+6bU @u>2$a$QFkqB)WWET0|/J G` A? TQ _$'2QG됺ɣRKVv2bXXpHD8:U\E䐇"0 cRF0I.b(?d@p쉒S$ ʐtF!T?F?L/Rrg-sggt`:eZ,aM8[Mx<Өt$3T96i2sT4$I{d,yT 6!o40iACILF Q9oP2_VVɔ\!> "Vg Wo_VD&W ֝ADH8 ѦmHY@48ֻ*0ٻ %ARx_H_ 9 Q!'`@D @M!pz O ꄈ) *Z$S\P #@ϡ7dISkJkM֤HNMHF-/ n )Q71 B# %%@m ͦXQ} Sêfu.t0!c (%κ"W B.$0""^aŒl V) 1h1xsً #gY2DH@ m1ySujtSĥBd rdF1A _ĀV -?ug9H}lj H0D27q)5g.i ySN4cÃɳTgl Bm4K[nS`68+VonfRvkcXVGL&OC@(*D2('";}2LWgA1jjTs,9Jݫ  -xHQa84V%?@ A Pb Q90U9Kb)YA>`2A& %0V HE ?09y9** A/9Q(B.*n2Z7 i1 CtߋE:(vh-K1''!mֺpZwH !1P[#8P]$b#7?,fH!PM9rV|B- P#24xT?nV<@ }0u 0&Է(D% VX+M0y&dSbL91N+"&CB*yɃ#hn^#)!\k@*@!H&B! ўB8(,? P8 !(?Ԛ% ELG1PJ),(#h]ې X_rDאB0Z_h??A {*?9d mڗ Ua @ Gܐ_њ3A0VTޑA BDHNndu<(yߪu 0 &R bЈĆx I2[U($UK9Urj$X;٦ 1& jHc%pMlԹ0ZC\ZCA U_U q?Db¨?I KK#?M@i _$Q NJ몑D G!/ 楑PZ?JN@:BPZ?rFkT9*yȋ@* (%眑0J1&/Jnn"9 /HN~ 4?.a%_\@)gW܉M7@ "b.e2ęKaO:!'G$ӯq r4k0JB~%HVhD $C 5H!ю13CԈ7jтK9 &!J<푴V (4Tmi"RHߒ-! BQ[NPmc %@p8?(9:V WD0@S p!9J)HEnxv&*vE]Pd8_!ӟ1T*t(2 4b@(2%"N@zMn~9"yvpZ( 5AՄn]ߺiMTߒPH_$ ")P 4M< t@)Th"?n|v 륤  Oh_JSRd*edl&#̚b3 C]H8c }+A#U8rTZԿT$+m n+JF :b8EtuTpC N ߤU+(n%HvF .Қ߁  4FtҸPc vFE j"& y$ E"^A5nG$S\\*d8Eߔ\BQAr(\\ E2\ h_aA) 9E, < ^I Ez1_ fR_39B!$!B T1 Y%F  ,h1ȩ! % Zh!Q_!њ(*$_ "CA BN__TUb#Xĕ  %#*DD߇Hɠv\ &t )9nwPcT (ZDiM )F9H$ 9 + EJkB JAW HUa5-_B>9n ,RI!$@2pWS)C(R#"K8 ֈSP! .L@XÔ9Jh'?#/Jk* ?Q? 00h1* ?$Q?9*3A @%(NT4_H? (?r5ᔀZ2p1_*_ 6CpѺ0nFr y8,5H n< muzPD 9V%U!!0R_`?R_q@i*? B"bԣ1TƂ+BPCZ?HiMрS pĩZVUC֏ LN pr o覍V/_U d+ ']S%J<VUr\LC=*8DFB,ɄV9THs5P@5 f`H Tߙ(H& g+( RI h ?ATؔ;uk ~Mhyv XmK+J*- SP4ӗӏ/ȣd$oF_Cr*_jymdHH  }V`AҎv SPpjI-ľaEcwY !)QD؁o D(p;@s"T)0JP^u!^N 餀QlI3{ HLaJ[T @El0z 6X%M%7D'A0ę>W'(*H n 3TA?_# o_Dm%`0Up- ) _ q!@m rArpDB_E s'0 h)"!,,NZW%ւ_' 9$ v%%_@m !w,9(x\'+$ *ybA#_E!,z T$6_"B{D _@PX](|" }@14U8Q P! \P2 8\6P $" V H [Wphrb_%p? +D<* CAW0)#CE(@.#`D1LJ* C$hD?BDf"$tˌu*l UF  P@`_4H! 69,?WH#WP@io$S,_BG ]Ҩd I頿c:A' P@  R|Aɨ ?%Cd*NI?b 9i?P%mo2(y D$`?ZHW%Q$-  7+_  B[ BњE)+e^ (ߕs8 ߯[S$?D T_U"9*P_䂚B0 A䛜XXQ5Uɡ %!A֜M hā@?+h_ypD* ЈD?$#S>&Z * 1M?Ɂ@|֝r($ 8 MUt!?QȡBŰ֝_< HG20hB0 +|E 4q 8_ yFhM`[ $߬Fȝ4 BZG$7$h9UHQ0Һ?r*ՀHNA5Dr. @ T%/ YĞM_EH (n"?9AE@T %ߟ=S_ʢ@-G| %^JjD?߹ȁHI 90@_D9Uo 9豬!H2!j6BZ0:+-F0<#Vw/L25E ;l_&P8hJ" %oW  hE $\WS "sD,#b)@ ,I,A H #"\07 lPZ`M6}JtT >(ٚʟU"?JxoC$v ?q߱CğB6DQH3  @ *X?  vɺwuH?PIEAx`%?%/ yQT(B? {& "0{fAr@GXV!_ }U % UDE2~ S\PYrTWL`.C!߀TD40 9 Hr "H^m\a H o!롩x}U@mauIJ$p %* C`߫N P I Pܿ%`?\Aps9%p J> 0_ $a+ VV@Lj & i4qc0X"d ?tZ?p<*w(%J B&JaĄy b_W] p *`_a#)&#jDSҺ-Z##Ms,SpZےa#nB5ȣp$Y(ǎp_ p"6}4D>Ep2`FFLH]J=DXp[d67B0lΔ PR)B#w!y~D0NjXPĶd#(Ȭ%%bȀ ,@Q8 tAaE1Č m G\R_bPx k(?Z*9 M PBC?1r ,_"^Ap6#?wE,* D\?A+_@ ">YW]Y @\@>5?T0j? 9ZX q:&;2UmN2qptjQAK t9YDߜo-ܩ`GԖ qojUԏD  F- 8Qbd: ( (~h8ÀinJ\U}̻\ \?WP J?ZS?Df_#qĹ8CpFopQC CԦ? "ЉnФ*Zu"0Շ h[#$j"047U 4W+9\"CHJ & d2+ 09ZAHC (-`_Tȉ 8EPZ_pP# T%*5T߭* ߐd TT$   ߭"J?DPhw.BQDG M@hw"DQ?B8 &_ ?6p 15$0 *P_)@. Qdh*ߣXkU[@GL 2tD(H(_$F D"_9 0n- ,bS @Cd8EFm). DBwXƐT44fsV &Ł][&R&VrpV $n`CI#A@x; bU #*dH?f<1XDWYH <ӮQ4֞잌v["$7[d I)4hY8_!W[o!ѵ" .=X1+}["R hFt?.wBGK0ljRE 3TQq3  7(b Xԅ?Q?yԀqByqX W-jo|) 6k  PƋr0 KCX߮#D(B#JHi'[?Dh, wn#F.1l_pi1Y›WE[TprV&U11[ߢNcdc X8A@.LLV!ߐi Vkr&[#WgAA< +jE.5H (Eӈ%4JMR٣5q?Ȯ (@$")\IU2ĩD %SHh]q"fw"Tw(9pG,h$nSǀ?)) @^+Zp? 04_=8T+ " H"fa}k@h&&5+UChTU + # T! r#BM6bkr@i?e T+(yėՀ?I$i]jH@MUG"YGTǂ ߐ (k h'_Q@ 08^]B_UiYF,):?Dd5_k(S@G"N?ߐL0PBV Y00#XH3Xȑ<bwDPk#Rn#SAW;F#4l,b$V)8*-6SAֈp!pP};cAi/y@LRߤ[fͽQ]Z1C/\D9[ {*ac ՗+IK%1K 6h)f 9P1 Q6\)Z?)ƪwq߯( & MUr үb Tؚ*G_ RHNP @!$+S ְŠ@ "&2p(N ť",pȩ ۰E  ܰBT09 ݰ_0t *%$bU W (C4 ?8@y 8I$_Ft 򈠀?<*xT 8 . $& dFZQV?$J9Q@@ B BĊ%1(DDH 걥?!bQ$SETYSDH8 U߱HD%CT_$E3)(#*D4 #E!_ۀtnE^AHp/ƪq+|B$ w*4 B"Vj+a]B@XL¢"  N阉U4c1 EbJDJ8q0ihQdPD? pԴ= 1*d C m y58X[ ur rp> !jm01H;''Y0H# Y8Qk4RQ  y?HiM:?ȧt! @k'"bPK4 cO| 9v \SW֧xS\!<2L!t\K@F8UA}S /tEkPD@eЉo6"0y \ O$\fUt~1 yCw_0im.s'D>5Ms+`׿ 4. 1!|#NjM]2 nоsD0rbC6&5-`N#\.47w4^g62$~\͎@ h.0KǠ}\ko~9x]?{O??5d={p N˃OQ;B::Uv*j9xGv w}N =f,`s)?xLPJ~\H];ɪZ{ROOcz&E64'_]dO^ /`qSsZt>ab>WoKc?'Άw v+vqv#uX*~m[y / <9/xwx=!xU×zNO~~S*'~ϏSw(hQ"}Z|J&JV`C}U+g/v'&K^<\˥i/F륹4`4OkZk#oe-NGZs\[&\Z~x?.6Wgߐ=>7o[6Ϸ@%^7/ ̽-O#-&,ՀC"NX`,XgL+E9a|ӚKӗq #-!H=7|Fvv‡ S!ȻYɎV.,\3F3_4k0Bl?ǝ8{RL6`_xJkؗ1ɫ0Ƀ z6 \$pGZB! OJAi54Y昔%@Ϩ텆ސ8_Ҵ'6@k6k&siڳϯ|M4MӴ4nM4M%/9CMW4M4aku4Mӓ^('r?iK?E8P],66,.#_WEO+~7)pi?Wz_֖ASW&*Ӵ5C+4Mjn#\~o-[2 XM~cӏNh .XHw 28(1 472TFh?P?&uh/d>mW=74UuZko?1,(9Ʈ7(y / h.wCDE! o;B_5xoFA_7ԃr~H..=>[2ךi}>LڲV g'Mv Gg 6Jf_TlGW@M0ֈA'<ш)S(*hZkjF3d>TX,ɐ'f/71/4 ]o*ޠ/.=ORuRLQAoU&G /Tr xy\&,^']`_ TM{E׹\O[7a5e+irom}6\sv7ɫvV~ <=C\>~?/@AB.˥BCxD[E>n"./V,=o!>{}XnQ/@ϟ*%ǟDC Z$2=yrB.#CWZ)D"vqW ,^d]?з9\.og+4rD9uN6̅|!@< /#޺@U*Rkw.D C@5L{u|\.RJr<!":!'%wK 9HU7:S&Ki%Ʒ2`ב!>,(O \G}JHw/ o2Bޮ-Ҵ6hN4Uu\.2345 46-7@iK8 %˗\ks9&z,W]wjK.ַߗȹi66~3޼4Ms1i5Igr5m¶60me>ڿE Jl\Az' 6>)7m%,:;_WD_ y{ՁW%O)܂+"^rg݅ݦ\%ǾF/ޤG6˾v|[(\؀<`?]?d2b&?@b3B/bkA'Csykcn2'D bwD'EҼ~W '1BFzG9 ּHKI.'\>J|\^K#ƺLqo My!r_NfKyO {kBP9OQCf'ry!R9&'r?SVTE\'W./+I6",j.U@ d×R >qOW!OFfdFTu/ nπ#ѾH/N rst$i@]yuMZzV4ii/a\ol01,kI23 &Z?6@&@Mk7W.8Yy6zk.1Njv6Ik J/WpY\gb+HGO _.LV\w(kv'>?4uriCi?b0Q֚o\&km\%ޯ)$H^@ +/.M{+ *uE DsiF1k/jH:FS\\.MIHJǚiKk&VQkNeRSB?,ZچT4 UUcVVH.M z4MkG^ntzQ&^g@0d@  ׋.SuAߪWED$~}9 7ل^w|M$X :]4[\Wkf66^1_byOhThW$?.o7'<wY3q498ugV:̗:QU7[zk\T=|gf\ d{e"7my x_^4_AX.ߥi+8>?@KhqozuKc'J_\.(z5ZkNGI>.6k.F764MZQm4MsY +E[4Kz1a1M{2IdOKdTojtM~N1VLV`.f.vv/wxOh.Mk.8Bq5Wru{tYwQfMynFN9^WCJc@ ا{ORƯɓǒGOONO | }``O?M@4,2NSf=.g Y>? o~qMӴ/={bY-|G~GO/2˻\/COOr<-l\JS2)Y(mhK7QƲ6 A<6~QJ@~1hAGC|.%;uN4O]qOK:Y~%(E/YE.g\>FT e@d1}h>zB=~F ƈC)L$SLqGBeIDHp rnDf.)尿/^g]HR oDFڨ~KV3O#O @gS5^s_Ko ugGMuIc2:OICJirA_["@9?@oOO [3i@k[ MgSߙo ~T9~UAтۡ׌ǬB V7ǟ2J!!)2q Jޕ' ]D R:/C/61Vx# YO%U$)Lޑd F?NKqm\.IRɃD6VGXüvx?G" :-'AizuF]G0 LA->d+jQKf۾]쑂FlXhePM #:,SOB 3}vlOQc4rjک3RH`=88I׽Z|#DE:ײe?wjNC3uCf^q j<ٵI/Ճ@9=C1ҢHqJ X(2Ezo}LocalServ32ThreadingModeApartmevntbotInprmi߿AUTPRX.DLL>V-sion_{MpsdxP_gI|O;S/RaCMP'%NP#W@M]%fbNXR"חYVY-@4ßXkOgZZkg=R'g[[DA\fG%v\GJ4\eEUGiß hèFH }T++ _[ `h Ѡ7?w^Pހ0 "5`f WmW{ _  ? @7 wf|G`^v n O #%Rc+_ (r?*-p/2`ho4.7`O:=@m^jw7BE@?Hi /IJ~:T7iQ^!iΞ0vKNP'SUmW`/YP[]0y_MOgT4V_XZ\^!Gn`@. U<$@a?yc b0Od @PdW9< f^PV*`f'Hoi` h0B`k6~Ⱦ0^..Y + ߟH8 >\.^?`٠r0^^9ZݐA. @b気@9h.?@nZ{!5[о p]  B [ 'B Urp' U0 ޴ \? @RO G9 \Df"  K]?j!7$p'*780D?/|֚+.037 68@y[;>.APDHmJM,o/245ok7&9Frq[knIFLNn*9]Pp_ PoRP#O Q@Tp^ OTU W0 <̐v`֚e> wZkVV\aTH &ﶹm°ɭi^ZӼ'&@iͼ`kyfZ؆ ?HTb$\6) 04o'.  5M ` O O PG0\.!˃Q #O&(,+ -/'1pMk36:=F?B&m6E OۼKMP Op' |QS Va 6'I\^=QO Y\@^kfa c[/]`Gp[bvdnngy$ girl nPps@6O۩ uw?z|p`~pD,/@!/rh,v΅Ү, `^"yr|IpߏJBNlp i\MJ~/BNosBgpr6@5˜F0Tj ,`רּۯ0Ǧp9yڰ  0ε|[k޾ð ֚r@.Gp0 k!!@SɃ r@N7liiiztߋ˃ncMQSNom *@.&0&N:B F72\`Jr|vwI^‚gPMKdv㺋:2{7v;>Kvl46cG=g &. N2063&B2F+K7+ w=4Nc-7O;`KO'yB`wG#/wjo0F eے+ *']`;2BXWl n:$? N:>c1lIZ~Pѭ}nfW[tKRybW&y[рrhgrO?+{_S5/Z=T*AfML)K"O/Iwvd_zfB!˾+ g;? v>`e#7"  G {F^/ _TV ϯS$$@   4/  .5` 6 FF J^777trpU47f`G  J['\[:xO[#Iw:X#xz; 0HR..#$0K\HI['h 3F Lk&[!˼_LK61MC,8&n:S,;:a & d# M؞(A8ya oxi g;61z9_\Y{48~&(#y~ ^3dޔ2yo_0+^]w+㓇?GNdt+yqQKCk' OIPH }}+03ekmMDd+X!E~qjWo{6l_g FM ģbIDȼ+H^{^No+ ɜpWijHHT }G묋:@ [ hOmߋ^J\!w6bIyoY+,nxPw\FO!kNC KNm7-4++fB+`l+[0++-4[+ g+s0nO+Xh?OTbi?|iihXD,4ͥмM4MlXDK4,~iiȴ|idP<(~4Mf}мM4Mt`L<,4|iiliXH8 Ц{xy5BVzA0A*1})$H5/'mj+F/fkY%a6]f`XPF_F-mfi@OUY,xZk)8NW+42[+h(hvF0^\2&(fyyG.3^X[kx؏#Z~4H5y]޸l6_[fWh ^x.j*͞+f62 V5/>V`m0 vna^`i^$ 0ip0)(>WpP'3`,߂fvF1\/2&._[.4X@kYbF[84i@V5h^g&WyE@*m6T%w`k'6h7l$h*8''`T?ISetupFeڿa reLog'ObjectReboot_iOGScriptDuggevrwsilesCost?%!ntex'equence2DMosaTransf2WizardUI_p;tyBe C2gYll ރ[GEr'rlġEv/jMulti5diaW0 ^#y?_tic'~ndowTH2|wLimeG3#va4' r2Ц6o238#5Kab;s3ZCBlBos$O1'InfoچDZs'GEh0mGSo*K '>EngWeD%-A12oQE/UsKIrfa̰#m59qϴ doDBo(.l}s2;Imz2T,HG4@04W2WpCb.OckF-Fh%BL3_@4n`sB/g 7NU^{7.Og~OM,חO}\%Oy6Ok%/ߞOk/yTO{K^K^Z2O^.K>UO$^O"3JO|%OD%[*@^rNOejOIP o K^{iOOOD^O ǒgO ŭ% O%/y Ef}.ykOL^O/K^kOiZ{OK^_O^pO1 VmO ?O?A3BCZOB)CDODŵ|&FH&%OGIJ%JjK@LLLW^rNOOfO\^5PQR䒗QSTTK^kkOT:Ue^Z{VD[OV*WU^KX4KXKYZ$;O%/yZ [5\+/ykO[]%^K^kO]_K^ry_` _^G{aaaHsKbcc cde%/yef2 gggi=k3k撗n oo{oq.r_K^QvrEsހ Hsuutvwwwhd@xyt$'9yZzy%{{{|kj'~6~i.y ΄4uoȀ4^Ku@K^%d/ykO K^k"ONK^U{o/U Hsɔ䀗jt?qޚ%,"4.E,%Of%o5Τr@J^OeӁ$;/Lr z%\D[$O*/d?k$d{OJ^k/yOZ{K7+BOK^n{\aν2 ҽ2 .C; K^µłohK^k/9POZ{ɀʾOʤK^k͑O^w/F\Ѣ2 Ԝo/Ueشگƒfڕe9h/߿?ߥ%$'k'yOczO{K^IK^Z^ _d@K %(cz$I$/d$dK.?\Lc/ykO29kh/ / / $ kO <SO"¼%O%/ +/y *AO  rk% O ^k/yOZ{K6OK^^ONOe*O\cz?I4̀  !!2 !"$$#y%&O&k%/()Oh/y)+^,rɫo,z./%4KO/0/y1O13Ek%4tO4Z=B/y56%O68*9k%/yO9Q; yk<[rOo/IKbLrS߉1\.vTkO:.\!CZ)ڕOnʗ^OS0OLrZ%\/ykOyK. ٢&^Z{??VO?%@KB6Bk\CEOk/yEuG}HO{K^HIJK^ZOJL^MLNd@KOONk%P\QYpOj/yQ?RS.yɫSTUiVUW>%X:QOX yY|ZOZ%/\]D[v@.y]*^_Տ_abbaycdOdgk%/eg5Oh/yghnik.y+iQjkikkmȀ4nnmk opwO./yp]qrs/yKrtBuK&9hb?u1vKwOwp^xyOy{|*\W{}S~2 ~~Ȁ4 +B$k$/dykO+j/ $rOŹ%O%/Ԑ%/y3OxyktOZ+h/ii.yØ^OrOhsOY%Oy?oOUM%/ߩ&%/y2 歭ZtɯGOK^d@W^o^k丹OZ{KOK^ʾ=\s^OB\v^ĬOĒ 5?2oɔrSz\LͼvT_v/EZ; ңOK^҉%O*/yOfO5y% k%/JOh/ye+K&9OIN/r2%I^2IN\r%,\rr.?ﳒeOp`/%kia])Kostra too lo(6>6ixYvalid o??positiq͞SCM"zEfJڶs_IOj[g)5K3%lG6IP{|ISK2p(XҚL)RzH BRs%RmM8B$'^JFO o5N7C |~@pa>=  /9N/9T7{8ژZ^+DnUnFkn)n excep_ *<+`+h//1OCED^`oOGFkoJf/jVZMN`O#)p>E50q(8PXT%700WP Rdh`pxݧdB4ul))(nullfgbf__GLOBAL_HEAP_SELECT E/MSVCRT\E{m$JV~P~GAIscnor+OlDNe+0Nw%􁽔 run0AbTSS pSINGDOMA%#R@ 6028- {_9 inzyhepoN7kBt{ ugh spC fvliqaHBo6std;5pd viruCe;gKcF clQw)4_U/ Ŀ1 -9sAcUdeWmXGIcdH`3F7!jhmtP0چBck_/pv0lidoa\ oECrmp8am^ wAmm_09.ş!U)䙑>\V8arguPsV2fXV tu"w=MdM[sf/~+VisTC++ R9Lic6brytZ-]B~!#P:`7}.avzGetLaA1#QNAN{F=.SF Tbp~ DR`n@|gM4@Q'Xv&[`G/6 lk7-[[&րg; Aކ'&!/@.4\&hBΟ@KKýgw'6_{bp'G(wF OPH4xd@HHN\'O{4 F6l_8䝝H;h?\فOoP 𯓗9  /E0H_hANx_ _IF@ Vrrdw (.{3>u)x.Fw \NpNaOG7F#_~@޴ (` ܐ7~ޓ'n+HN$AZ8@0P_dT\_^m؈Wh@ Øp 2xO% g HUpFG2O,ޢ@r_K K` $'h@|r򂃄H^ŀOɀ $Њ" Pq+ %y!`28L Wbm.ɂx $r輀 $O8ǝA` Od (<HP+Odl$/iw΂P Ox@Ƞ q!/HœA^ o\O,'@2`@$\OIɑT_ 2 t| [HNp 2~5䵓mod$,4wH6^'6X` oEtOt@2^1(U-OVOXɀ $2  yiOЮYDfOD(HX Pr lwm5mr ^v /nBO@ l(OP)1x[wxCHN)XF.8$L p`VMdhpBxv ư_'  XNB 'AGOO_yiH^+1@X!OhH6+Oy(V 9A8DLɉ#(@@ Nopd lOH򒁆诨 y@8 do@rpANrf 08nVO 'O2E81 TOXh_ *S?mǀ`-v.Vt(|"w&y`m Eh 6Om@O(pEK =_$"__7DN 7`hVUO| $8v`_O9y{"O/OsUtDߝ&w 9r pos=nX` xA^0Ob8AhLa/=  /LO('@2<a$9ycny*O8dnp` ̼A7NE  "d@O8Hd Lp`HtTﮐ%ɀO_ ɀHH^ __x   6l O4<_6PX_B. }t/`+a!WrrB}4/,Ru@p2서 b ?:qI.N~./ND. HNH^ Pv@x?$?0'SH !>3r `2D95@8W8 @^;yHPX8AHltd|d@AdHdؐA/yd  ('O^! ( 2ȓ0 8@H ɀx\ 2dlt| 2 2ȰAAd$hv<9  ퟀE“@ H 6@F\ɻAdo6 w_Ox;UpoKC ?L%/A ^ό )_ A_NoNEO}YON<g(Oɓ  22 G  9y '/7v '?GOW_ +@OCV5]*^ OW?A;7B^Y)Y=Y_ec]^o#0/^O'"?>olg\s@r{~ 0 2Ȑɓ/ 'IQYO OOHAi *~Hg/g ۑ/0Hv$O8@Ld`^:@_O8[Hw_ $'hˈ2OhO #+(@OP@2 Tx" hAHdOH^ d@HpP *%OHd, $/D2 8\` @t $2%ɀش GrO @2(P!2xd@^d ,/H@r $X@@ md/΍@2OHd  K 2H #lgp/'O:EPy[fq|'O< ɓ 'pJHo(C>d߫4yİ<Ϊo^ ,_O@2 F y $//O8igN/# An$,;y;4<DҨ _##k'yv~a/ߟ /<9 Aڙ o#.y$ q<"H x_u1:P;drv^?>!Wȓ!$8/$C$K$S[䰓c/nv 'Or~ r d7 $ϒAȁ!@l#9A3B\˿XȑCC|TD5K^DO"h# +%%%%#+3/9yr>F NY r'a it'9y|a%J%#8r#FGRCH&C^ I\K^JQJk#d$d!}p&&& '/) 1 9yr9DLT'_goJaz&&W$LL!/MN{^ yO)OOȩO%(%Pr)&&&ԉ$QOr\0B/2ϬL6 _~Uiظvl.o$iֈ?&0^e'H _`kOLn. Oyu):P&'H&NvbD6958T0ݐ?#nÈ>??DTOTJ''`3nHN8@ y( (`Ȱ'd'lwB0'(x9XXn|rY>YY5() b_ o5Z_)P9@vÓ/`) mNؒ+e^o@*@H^$'89yڹ(nopd a>6 kdۏ*jmXˮ+)E&hr`4O@2 H1 \pVO,0H6OX@dBd *- d@H<1HNpɀs*c<x$ 2_.ɀ ^0 ` 2ϰW.+O @2H^2(/<0Pd@Xdd xHЁd@@0 2 HpȀ $ W,Hd,D $/1\K8Oa`_r1^v_u'hX'BᏯ2h{0@nb?,/ʏިFߨ '/'  & rً6 oб0[?HF.^w3 5-v/'Â22 = EM U2]eOpx3|-iN4@$hOh 4.y+O4KT5h9PqM?5.|A. 'O> d/d5" //WTn6/5!Ȱ _6O<\@r`/ɓ`hp;֮?9y? >H_Ldؐ Td\Sl7ς@N>`_>$a> ā%_?]O4?A 5n@0$_d CX p>-@_W y rvذ ? /T0l?@!VO 9y^6 oW;6^A(oPX`+AXlOEɨvɀش晜H *F4ކৼ.Ϙo B8B@rUG8B!W56B [O_)7CO Ȱ,_4@ɀ 2X`pv^!gND0'oM7Fɓ֜v?  ? 8ow8 Xxp_-A ?߼DmȑSHDDS8D|tMa=q/OEv60WE@)=_ c?8<״D@>Wۓ'_j6lr}? #xFoYo _Hw_F6XFN #3S)?F89'9 #ɳGB69(0N=u_GR2Ũ9prrr9999@m _H)ƄHd@Z"^hb?H d@.8+䵁OI" :(+TOOP 782 ldOx $Ќ%J HHdp@'+d;$Ga rOZb?B?K8<=G<䰓'y2;2 AN89l/kK<`OL <tH$[" >$yC /O'^+LL,H!8LU>PO^T;@rHlwOLZhVVOXWyd;.'O<yȓC  'O<( 6 D Rɓ`n|qW'O6CӭX+dXC5F5쿞H ^(s_+XDw#oD?DD22D OZe?kҝBDy+YOSc8fۏG Rg@oYxAo[?UѩoOY$W~7o $ OZWȀ@Ed h$H8 9yLvc`?EkEv~ $G [ 6 'EE˞%"BG +^ oi~7?HNAG` $\Op ɀy@2ؘ_g ('XȀ $ ȓWHH$'o_$ذ5 HpE/``oy+olt|tX'`X!/UܭkxO`(EoH`B!8$Gv~aV' IV2Y (bB0 /B@HPrc`h| nax2II bbA_ɫV9%obN ^$ONc'OJ OIc(Ժ^COfcxcܾBJ$,4 ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  /x@K(Og\j)_gN+JKe  xC6%9y^%[y0Hy`Pȉp _S`!Syx&D"x&X/&z!E 9yxdzⴓǟ+*MrJ- AN$68@Kո.~O޾BVȓ'W0y! =y, 4  }/?JU _r:@;Wt|n q;Ȥ? {2WW_d ɀK_H l $,π6@_HA\dd x koA؁H_֯[?/*nIJ0YnD - r"8@KVO^f=gHL oO&?x{Yi/LȰAn 2 2 ,2 &.6 'O>IQ YdOovm89z_ r"@'#ON$i&% W&xY*EtAOSLxM?0/Zyd;<Z([ N r08A @KSd^itdaNF^ߨ'Oyg[O[An}O\ AN ' !pܮ|z%U_)_;\pPOhɀ $dK5Oa#o N0p$/iԧP Ox+d@q2 $ $8 9yL@$2l`_hp@^gdWA (_A qyrl/O QD<JĞ(ށKr N HN$Aڙr77?JUO`y'kv/ l O03XH3orn"6 ϨO<4r)38ω6[UdL!^8/[44, < sO%)Cr @%02$H y!55!O^5B^s8^ /666ځK8+dLTPB^8I8k8 y^+dx9B99핌| 0sT aX/ O:[BsO @OFఁ%O58t $/O`(_0d@@2Rd dO|2K V ɀ $ظ uu@{_$O@ ym 8h$dLT_` p$HO $/ikHɀ pܐ  2v^:uv__H^H( Kdχ TLD2 <\;'O?d l t 'Or!W;А [Op $2ؘiEHNޅN $ 4 N@'R!LP0@oxlt`@OdМd $2H<ɀp* H^,6 /_HO @20\Xt)OH{ ^# G$rAu@?%܁@ UoH64OHK\2 p@(@K0O^d а+^QOPd@$, $DOX_ؐd lV)o72俐8 $` Θ2 lOK^!2 $8^@O`HF^`A ticNȰAn/r; O+ فyO 8'N?JyU`hpy<{#l 9)> 9N G|[ɓ (;y6D pɓW\grA}dM\ȓ7F$N6ɓ;qEk//H^2@xHowa>Aɓ IH3nTr6l)lÆ wd``X?ApvNOG,4#O;~?ذAhs{99la (mmN ʜv  ӓ:x jdO $^@H 9ywn8 d\d^ɀ t|oan 䭈&=FɓG*U 2DOZVOlaPd@2 ^O$2@ yOhvoCg@nHHNt'ϰA| $ְ4˯(@Na,^o'kHPq]F o! n`A`ks{r;l/5 OɀO@2 d y8ɀB`@2 2 0D $X'Ol2 (P @x$64?3!|`w xa6ob&uO y~? @O@@;XhOy 9y 2l X@82 0(HK `P@daA|tK1dOd`ɠO 2d@^!@Ndh$[H__@ 2 T\VOpH^d@@h Hd.&&f ^n$NA,,p[HoHm 6PXۓhD*3?hS#'WH*dkH^_x   ώ!p *[^qzr՛Ƨȡ\.ޚ *P5}IfM]C_<]r4/r =\.G\S[NdZyrg!'.+uy{1Ar\C^P~P ˶.o +0=Qr\#AnT.  r\# \..+Br!.#DeGVo2{f\.6{*|?v#rDxE\]/_N\.b]̒hr4 ŐiD J|w /Q~k/_QC:\C[Q?1es\isv\src\Shared\v*-s2NmV+ia&AntEx2.cpp~%EKS.?AVcq_} ?@@@%??$_CEr-EM$1?CLSID_8)z3U_GU3B@!AA 9*SUB0OG\%aO|(/FEݬ}TzR_#E}-P&POZ{CU*E_K?I% g^4mEMAF`= 4’y;)"' OQB6hN\[DY#Pjst.hݱhTD<[i,_S-I; !FiB..Ѝ];>Orb^|5m؃.l`D(m /'O{V7/QL DϞ6A*.MY6Y6DKAL6G{)+"INIf˚EC6EjCg7kW 6D;VoBUOG6P]YkfNNMKOl֦GFHrVG{i[KߧKY`ͮIb*;OD.R`]CfIBvHJR/WPN&(P.k_:AZN//GSga:obaWpyQ= es'b*e BPpƓWRW_FN)8t?s_۰h/*LgjTY?f@7G:-PpIآv?G NNUbwB?F[D <ΠOpWgy&?safe_arrayB!5a!܎/Btri(:7g/0 W4aiA@>aUkermN_hk%d  p-btreeJؗ6QZ] BWM`)&G]LjW~Uw;,YoP$ClsFab1ry_Iž f&E3&R(݅gF`KoSԁúCU$DTTɡuple&ooph_|؄x77ilDKS7c=%s c@t(getv16 _Vl? !l-out_of_n؍Ave> bs13pV Z!) ?D:P3:tdYiDQSTREAM_ ATUS_cwѐ?w329^G 85ϴ n 9-21 -4Zkg;B30BDZk2"3 E"8x fD[Ku X+j[_B-l ҟ(&?pBG nDgOJ_TGF8. VWκ":Sr W1t S*f^w2Ͼ \sc/s]m7&Wdw*\k_gRuB^Vr.{Zi>n:U ^s6xl&Ih? 0l _ ^m&t` bR#V~k!eit\olS?Q\KnelaABFiC!Vardt6ng_ljm.p7s#Km!numDZ"i`k7eB"z&Ҵ]/dem n"!*mqCDvyG!Feg#_6{LY?T> Yof*KE ?sworQCacheREFol^*'kmNamou\=e_%4ݠJm\6x#ܪxfc^vL1usyZkinNx6;_s.3iHPUR_2S/ŅdoJdYaOt0N>LGF&Sl'>ftwQ\\{C3 /m\U[ykShie / oB0u,F-сw8to%sЬ\{.NLEVEL X0gp z_, De FROMOOWeFX?^_SG?yuDI!_)%!-sT4 5};AExC-dm3G_@oUnwl_Kc<-]I_t@VUqt{BOϱuVF ĚQtOvuwVr2/hxExODg6E/ad "F&Wv7 -Ne`iGӵZAlwaQCheckVj-EMQ_yL[_#Dkj$snOr8ڹHh^7L[v5m)7mWY ҍT㛪'.JUgab!݆nR s)rIEJq oWcY>+,QK].b<tJxbuD!.9'Mr+\h Ħp0O\;\6}ml ? /REGSERVUNf LiR\o!autA J$B!A(>0/I 9B54Pb:qK vC'm3\(Bv:ғ&Mc cZGm_Fb=vsp#c0bCVA\@#UsH\GOSy@m.'AfRNEL)7*lC<">|p> Pa|mZ%SOFTWAsDFMt+T_fc^KQ`F CrQ%Cd. O7SHI[D3;TUPLANGUAGE7duQ Aс`LDh$ "T*OJϣB'A^#1JR#%hx.A$!OH*BlH 5hZߍnivgeROS%Ogр=@Ex\/6jbFo[lv;yKBW޴5 GUvzOB "E:OobK: /WJA ϡ BڢPMP?BA$$('ϲ m`?L/ Ġ# t>ѬC?_¥13qֈoa#1;%@+g=R[W]ԦiipdXLb h@O#u&b '-V1 8mir 6+-/a? puw&Bg7BL!iVfHpC^da%v 'Gthellh/.+T Jl@q&r+ԁh fN{`)Ka:W(.`l rS5p+xAb "`3y:n/AVC ~#?wܭGN6A?B(/ SSL%k 7Ag츆8I8%ƿ8ah Wk,1nU iScqHGahYtcutKeywEF ٱ._}1#2'A&-$(¥u} OfByTo(Ҳ 1%:Is) 5! `3?w2n^-1TYSTEMjYSv {\\s MC=> ?INT.nWTjK"bTRAgthWbXOt/90s_\um(lBGĪd ︑8"PO CL3c /q2pp Wm.k\rT ;wk&vZ{5 77`k!o)142A*yZ\175X툸S7&RP/Q,\S_S{&bWMl[W1 #H:;bF7/jY^/`E_'6K>H Av[&b*DbVu;߃&VuR+Txubˆ3i`mISCcXGĠPu>OadYsTetu T3biCvV_Y ZSavegIniHE' Onlybrͨ1aK'# -u " "NtN B`r uaLuZg`#?Fb0_lXc_őwUN`mJPAD,BH6i;=X+c_fpca0;;BHk_&rJcO;A~))RaisvJ(S /wҹh&@lHelp las`M! _]NEчD8nW"K0b$FygϰUT $v88no7>^k"<w.TQdCG(n)(ne )(X %WwASbyref))6[NGHVAW24+#ڬhS7A 2%= 6ApśVׇkUtZ b_IX7VMOjB/.%".1w`>/$B1D超/c=&͏+%<=ﳴw;>=7!*N~*Z;M/-X>P&^j|G||[A +A~PTIm jp$/uTchF4uHR_p%U4鱽V!K‰FzLcb.rz1ƍ3Gm1O#WBAa"tU I>qMQhodlags/aFlnvokeviW\h7Bjh 2(loWUߠJr)W#Z h7x?TB1?\YCd|?\bF/[dbm!GwmfnIޭMS S3 i V D_ܺd7  B#@A6 ԯ_,7[Y0 ADlgcacfᔿ1*h-E12j-Ls avio.1:tkഅO?.HUB1@bP8E(*B?PHD()"4R_WImWg_⒄QO%h=,,i 9;UpdC e?3=$hOrUEW.#F X!q% m-I.dB{z'j%J춅zI641P-u019KBBgٰl(F.K1( WšjV|_h.7[i0]TdXOD[T]:1]<ţ`B.s`ƾE-`n - BJ{:.G8k``[a X[!U.cMsi7nUExaWm'dk:IvFU&R!?S}UE7JPoCo7o&VOȨ1o`ts_JgUJri; omXɣNJ[Fl$ Oe CA ,2ݱiWGffwCm$UJ HY ecVcOЇwbx=NIso!%{ !h_OnAX,,WeqD s ȡ 3WPR C- bA@8.Wd^%Jpv/[dmZDRtc1egx~sʈR&w M{Bm.gM`!NhZ, &Г0 Tۏ"LGro ,F=بcPǭ .Pso@ QC+/ ]_wReVHKU.6EolTk>Qa!You mt/OV@UN-fapƴ KT7ycyWnJ,sa˅vGcg\ҪwhnlisHO /p[pVہ߫>pcBU{<@. u/kMsq1lb nZlWspC-W$; wckc(w)De mM0xvoRnUI hƒenxsa#jOsWV7ZN )L '8l d'>vEm0:v688,X 0..A;O)hL%PPHELP2ISALWAYSaVAQUHZeF$Bp,\Yiha؊?*aǫT~MkTR"hX3V7[B'G71RMN>EoD14 @r/k.9MdsVe_ PSB- UrG =qe.ZOflK?`'}HOW~ _PASSW_DIOG Sk<_ZW+ΰD"BߌDjMULTI_]KJCOUNTMI_S{ENGEB7E+!MONfa2HohZU,!{cskyp`G GiNI:x faibjWIUnjf29n0/RT%x#e[߶Xfio0jkJc4Bx827B5F,zywViX ۇW #@ $SE"Bpm5߄\Q-{P$"P(oFMTXkA m0JpApr ; >c='pAc H(Co1pѧ ;(P"TD"E?_nkDV3pV& 7&.{% WxIUjDI+L-X?3pEZb4NU: &JlGvfKϪU-E!o v (1 ^qHnejO%&ðRZϟ8u!4лbfF4ChR?oV rC0gYRhk /obj/V`c}=1Z`A?ڭ8Iu@j]kmϸוIGfvX`0/e@ڈ7=m׭?K.5-̮7u0?:w-+@V*r&JdboQHҘ!!(v\7.0\ExhB2W3ha + 1J+?( nYH.{POS7_UEQUE vhQ,Dw[8!+n.&v'E҈o=l]Ee0Y,,'=SZ,!c ieVQۉm([c_vtZko>sox6N* 2uRn%l^ maR:m%roS=pfTm2< 1_g35XC׷"hfofg bb,Mp kdԈjxJG("bx\!ϳInj ޭ\` WUNoz x+tOR /;k Up@'DeISK1TARGEoЏVPmo@/-ѕ&p7 :OOrQQӅpQ,WfEf1 s.¸C7DFmCA()0jdsGc kƉ!9E1GL eqRPB eVKI(@Xo}؊cmdlK&<@ֻGYsaG/7sMg`V [: 7rRIEnh'jt2A$6JWZH (7RIPTDEBUG)B`U],1[+>CMDL m[]+PaCOF4/1(&OP&OBo i!To\ ҭ?6B&KC ?Wn^hv/E*rf OOvL:Cl.qRU'n;K7OF fSkUWzB?ocHB\|`@0B%K1MAƔ[Zh o?5+Y7\g. {o)8~X#4ۘ`2#03}VZ^$[fdVi$o4Mf123454M678910i12345Lk6789N2M4M2222224M4223334M33333M4M3344444M4444444M45555M4M5555554M4666664M66666M4M7777774M4777784M88888M4M8888994M499999a9989 2H1232 456 789d1111dA111dA111A222Ad222d2222dA333dA333A333Ad344d4444dA444dA455A555Ad555d5566dA666dA666A667Ad777d7777dA778dA888A888Ad888d9999dA999dA999A2?22Ad222d2222dA222dA222A222Ad222d2222dA222dA222A222Ad222d2222dA222dA222A222Ad222d2222dA222dA222A222Ad222d2222dA222dA222A222Ad222d2222dA222dA222A222Ad233d3333dA333dA333A333Ad333d3333dA333dA333A333Ad333d3333dA333dA333A333Ad333d3333dA333dA333A333Ad333d3333dA333dA333A333Ad333d3333dA333dA333A333Ad333d3344dA444dA444A444Ad444d4444dA444dA444A444Ad444d4444dA444dA444A444Ad444d4444dA444dA444A444Ad444d4444dA444dA444A444Ad444d4444dA444dA444A444Ad444d4444dA445dA555A555Ad555d5555dA555dA555A555Ad555d5555dA555dA555A555Ad555d5555dA555dA555A555Ad555d5555dA555dA555A555Ad555d5555dA555dA555A555Ad555d5555dA555dA555A666Ad666d6666dA666dA666A666Ad666d6666dA666dA666A666Ad666d6666dA666dA666A666Ad666d6666dA666dA666A666Ad666d6666dA666dA666A666Ad666d6666dA666dA666A666Ad677d7777dA777dA777A777Ad777d7777dA777dA777A777Ad777d7777dA777dA777A777Ad777d7777dA777dA777A777Ad777d7777dA777dA777A777Ad777d7777dA777dA777A777Ad7776d778wwwwwwww Ma?lSm??fŸ?d[?922A222Ad222d2233dA333dA333A334Ad444d4444dA445dA555A555Ad555d6666dA666dA666A777Ad777d7777 MA?lSm??fŸ?Maa?Sm ??fl?6? 2111 2 1112 111 122 2222 22222 2 2332 333 333 2334 24444 2 4442 445 555 2555 25556 2 6662 666 666 2777 27777 2 7772 888 888 2888a)8?m M??lS?.>jM?EaTƵKJUX 7Ƌ i6*G/?ELӨ.r ,$tp60+$<~[n_dre~ $VHR@t LlpHv[hKXS2 {ƬSCLWDnnat^d/i"cw# WpG11 ugE `W&+ G3 n-m7Lb@2w_ފXfk 6v`_b:Ob,NU$o X/zc3:m/BwII# )σT6aVĥYx &=.TAŠ QNy:VgN2Rw:>7M#'uc{X‡d;m+~vI5Oh:w%1XFon vEks+pҰS%;gk>^oPVF[H '7EVp"n#[f\ofCau k5Qnc&ZCgP15 7e x0/OIGPQ0H6[G _2P0D 2 AY/(ec X,TGKG?v 9D?/f ~G11`?wNﱁI,D:Sc9W0,?Atr1?XDTni@ad'\~xI/.ۣ% 0`_,R^ /πȻ@ ِ^ d S\.p&-@O @09'O @\" fy@ o ` 7 ' ]pP2r =A !$ Jb' '@@T )6ˋ, .0-+[T,/63590;9if>o t"AP=%sWC& ,ˋz|@b/ٳXlϠ-d5Iory$'P), .`۲Y0249F;m_O>0@D @ȑe<` GWI)L0.`؜(d p N5P RNp9f(ȧ TWP 3fd f _hY.jmor> D.gAI?tPvͦY.x{}P\A5 J9:pмUf'oZ|?0.8 CJlJ#ObthQu3Cw%s> wd) * OtegE|Ca,n@պK`IQ:v֚YfG8S m&.2M/ #v: (c) 6^ (r;t m4 =nJrpo!(YxRdsQjpܞFk=085Y.AR&{~. "dNbos|& c|Z._{A `NVȚ%d)_  )بo%]'sڷUb7Av$]B[e'@Gunicu;Url27QBzAvY-7O'gMHttmqu A!Si'o@X[~'?ؐy'Autodnn # eGk)XK_x/lsj0 bFp{.r9F(Vږ`>KԶFCua-7u]' b'Vm%'w.'& wnR#PAWT tFqji) xyb9߁ұ u_L0wBw\moz{\6pscp6T ᴷapo\s`(\\cޕjvm6:Gi P_gP.L`f=9oT)SKIs=F-`vG !FiWNai ]vNX\a^_[ps.jo1C:%20biffVxI7Ag&8Cf1qdcE =Mw%\rxl;oEIS  8B"w5k.p=).aLc_l"W?1_iM_-"Am47"_ssl#5K!6_XDa7-9.tRq'b=%d'QG &q\}H  \ΒKĐk&x'IsWi64K?N$CFfoF+K o;*.+"N8R%eJobiBoS&5vTo5wH7vױW&sINzkF@kԬ/SWGhoFmvNtHQkj!/8[Rai |oTL-D_C]V~rkgѭTadvWL1ULEPATH‹5ے€m7/gxHKCl!r QDM2>u/- J-'I^?e a  `FA2( %" mC `!U w )3Q`tL.C6C>BaE0D8(? V(7Ž@`y!텥,@~^ڣ r;D'@_AϢ;{[~Q%p^_j2%؃|s1~ ]4;h㤱v i& 7 a. vyAڰ'.! 5AC 6PgR/SWaÿYl/mV 4M pr6l_g?flA) 2??y'a  ͍ Ȁŀ Ȓ/ x?ɓ'O \'0ɓxP<Ayɘz7Mn"UU@Rl(IUP-&5d@& k4qM4Mļi4^|ixtplhid`\XTPAiH<4,.MӴ$ii&.lŽڶ^pApDTgPDeE6/i5;Zx,0Nivmmg:YwTN/QMlA@y@ y'P$O~Ș 4N@ p+ŝi@]%O@qוC)@D@<զIxy@oGAkU'9p|Bݎ~QCv)/&D(DJzEeǑF e uuvHMXB䧓9;5SM]=];Z] T7aZ%]g'Ȼ]݀nLɛ R`%u?q= ףp?Zd;On?,eX?#GGŧ?@il7?3=BzՔ?aw̫?/L[Mľ?S;uD?g9Eϔ?$#⼺;1az?aUY~S|_?/DG?9'*?}d|FU>c{#Tw=:zc%C1ߊ[iPpHvh|{.eiO3*?)Ov@ko*+;n` OH-i6N6v;1 28V0b*'1;oavEZ o*p (* 3 Z!e L:Zrzg34BGdWS6nٳvCl,A 9ٵ%5UZ'oX f-~G-ڳ[kB69:+4[(2)eM1730S(&u ZQMdlnݢ:a2fRYS)Cky&ANP;C 96J2 f$T/A{tZzBhw;sJsE7BRm !Kqm7 3 hB @U,(P2 d@(*QT @FP@2 d:CRjt"mBk& W4!<A&V!JwhB[ &{kwJtNnvώL2db20t.*"v ُRv+&en4A'NfuZ_ 6 OprCqNеcfuW;2&4hfSշ i0vi{И+NkGb0 x zku X$c Vp]s_mPCimF5OSovoa^C ׏5LI?*.☊#lw#v,"Fg> 6s_`(. %.)(SаvDi t %qB9bDD{Dɢ@P2 d@( Q *BFTZ">BXgGeZhJLCID'US1}AJ0ٳ DyF$j ]Sږ'5m Dc.ˆ20-)}Mov[栬A-YvwQ$Id)ODY^P2{#rX d h ep-l !q;skF-pacRac_`cmpiA[FEY) P휒R(XnTo8;xwk1z0DDD3`4-t }ar7U7WE !--o#%+-XP%Zn9/2JRy3 @1].-.i;(tv0e9[NaioSy]} A{x9*TpΔ ick:,u%r()zAMSږ l5 ˩`  LIsB-6 [:H{s?_^UngpViuSewOfkMچ}ꚶaV Gb;nA𢶶XM70pW^H%p~oy Ci.+SlushlBuffPCAYLeJ*4M-մÏIz\8led,28gS n,o#VܳD >}ba;pAl4 l5Bb A) EH`*uLvE Cu$9+InWbdGrT((إYAQ=Sgk) ( iSWRתtX]תּe:!iFEYiR#(/85VCR%vvȲ`dtķEg@*,UsW%b/_ `ł1i`% nMY5 P15Jl\rqOEMCPKÅA bhoWA=Vc3  =T^~LCn\Hl9p+kX`qAK-Q!/YX8'8tw˱k[6H}S1.eu)u]mbAçN-]1ɤ,IYG\gpLAKeVY0Z)e ,irF#o q# F7+EwsE;u"i~(%c#9)mUY}@!U”bB(q":ߔc\lAWdo;lDCMu݅aPxt0V32S.]R 7c8ө@"|["Csᄋ;oIdڌ1 SotBrySS*+CBk!wxTSl-Ou#wtBs[IZVviPa.Bl0fjp chƌWwC]=gn+~njPixO.Playck!H}c\l'J&pK<[#OrgֶC? qrːm tB8#Fh]AJFamR`3=##hr'5 p_xYeY|[1KeYeO]CeYgYeYutIMeYeeYw=5YeYr0eYe@z9eY2sy?XeYW.!9gsTas20Y{2HGuml/a!0vNb%=GF|OnH3@9qDp#[+:ra1imXhs ű5Iv p9JzMKGuj( ,PSpaKqoIi m LoxtPS1s%Siɥjك%;"  !-+ى.p"m+`{e9Y Y w hd (y &,˲,%$#"!,˲ wubx_!Hս*8~ENdr!lQG2_o[m75MD-Q(|*SiumQ"u!l5GbK5M jgTaJ%v0_!,'3a :$+Bc+6Åz+_`E&gKh'ͽR GZRpc QACPc=_ǗAivφ v1;kmp!lt0Fڽpt?]UKqЦ-j23_=_U=Qjf-#b /- pwd-6F_1m=-մ7c5^̀ Ǽ-sI Zed`siüSHaqZSpDZ@7W7Ӽ AC7t1%i+~5O(%? *eZEN ]U8 ?o*$(<D3V?* * (,=bB/*G /&< &. KDA5DQU61yϲ&_ R :e+,)= '='YD.d"06%t4Q t2 D (*!  NjR)|xa;oFX, `  xY$_[?JUy)|&$   7RrL8 + #[ xzX". GS%4 j"o"Xo"(>,:KO?: -%?J7("r4_!F8@7@/=` 0D1~2!Ƀ noS9)"};6>#(.; IS$_y"<$S /a<  16 m0E>IQ=n*#= &!( S$4C -X s !V  60V< fw <#?M5=v?x5c5?}!$ f.,k:7_5>R ;?y<4Wf `OP/J*SdxR{m,^(D~.!4ND%+ ,O 51> t+ vA.[A? )! +&'- Lj5,?: 4'__E\,!@!#?(1DZUCU--BDT1*g .uS?a7SS]|m-?:6!1!?$U0=]w(~CZLx1=4A+=.U= FMp_=: F~3 OcSBl Pn%DKd\bvwXq8Lqk*:Cش7R ` J%: 4c8  3/pmu?%  7:= 2;7 [ s=?F. ammq>U p}9ydOobWW} \~' ޣB&4L>?~\ ifJbS* o-Z7t--  }I5Bl,7|pqt W /M}0M"95c+;6*P>,47 -x=4עmT|B/pgB0.>h/:[.WEp?{? wt-?+A8!CXBz&=.DA!46T7A4U?'m6-EgW|ER_tp|GGQrwtA()8r0L+n&E %fAt$/-d~?Jq<+ ;~M@>)RA<}%5+?'#; ?#.ZnT G& q }߉w/3*aH?0 V((+?5._= bD)F?bs 'O/v1h?3+6B]a"Qq8V[4ALIs&1 C"V>K:=h3B˃(bH% ~/vvN>GT.-[L&NoY/# *0%??s! $#RI L> ? 'M t$_C#c'{`9a#)%(Ti#b"&/.v/" J%m &9C#! +Q 7i?%-ot *+? 6H|ݠ,# :wV*8)r5g8A&_e[-[S} /2! 3D] '*#w'!&*$ Q)`ގ K7^ #2EK"h%4 &m8M,U4LgR y2gC &6F+N*=aQ/[K 1{''r !C6" ( -%:H<%]vB!sD(HHWfK: =́WyJ'N3- U/A_gZ):-?.; )/;Q)TI=->MN9}2>a.kS. eOM>(!e5 E)+.1+4R9G-UO'89MI@:<-oxW5 3c& ~Op Y,6-S1nRQ[. ]{lԌ)2. B}8`GG=yBǢ73*\m˴:1Z]k:ALL<E $I RC0 t$X|2]+ozQC Ą/ 4G1s]]x&%*o9*GlФWM0 J(|?" Q2& ")*#Vh9CM"Q# %v/z#3 + `'HәR9 d,"? ,6<Iy~5 H  2!ok5_~2ł;BkEh 60 Y.DQi2,H-m\/ B(3//_R#2kk$uWq 9  Io IML Th&>./K*&@($2 ,vxW"("("Q(Wh "}Gg$")'L0->c]c> UIJI3{p1 #fC=|"%#g|<-X 4|`O3>P-D!J̩Pv{FO&2@-^YPy6n홥&VVf3iƧM'P -TBNN)%P &' oǞM7 Q#!VfEw}*!=.-gF0 >CZpFEW/UZ G:.S7Q4[^AQ!Z(I=+ceNsSar$!W,M1(V< CV3 ?[Cs X+N)vJVFaR 3'J1S*\  MtL! jR i-JE.'G`{l^u/Q cUo5L 03]i2_OAiY;Do=3߽ >EB4436 p 8''1$Ih)%NA@. (( >< *"*% 6+ |/%%-: (< ^WK @ b 7L| &N@S).;_GTdMZ:\ r#-@ \ +J ! LN8H IvvU=?FCa)-1ipqx>pB-n~[P[<4&4$(1s^]cx'mudU'\4J y&?,~=g9 A4h5߈>r6pd(5I ]R$$hBb$M$1 ~6eL d{ <Et$~BPYC A-J#2)&[lh8L4I G5K NW).(AAiGzR )6MUK3.9/<|2}P7p)XN-"K~GN6\f#k!31=v_`E EC7M  {I4E= (f?3!G :A'; #<xF: a M7g5(8g-6 G; cGIG8}7057/7,78 /S'U 0827!WG$ZN/OW+Ƒ.%3gVߗI/^ @=0/#By?'م>u@{?0.+Vp3C_Bvrߑ ;# |'M%>!B,KK8-85moU$PW /Z4C96O_4; N&ZC22*B7[ gdSs)5/5xCKYt8Dý"54K41 #+JOc(@c./59Vs !$,HLA>)0p - 6S0y7 U5sMT+9lu:ë"e\0>+%! 6C-IS "s C -S%=%W+5H%+ '5 E/lLSKP)L#1 `* 3 < 7}j)3;s.# < Eax< w S4  31-&%'v1.1K6W$ .V1AvpW{.IY#^U! ?~!&#>ѽ7=;1 w#!=)C1FA!,~4,B\(ZЍk-Pn&??O / $0foN?# bi  C' .@ =\#^z3_Qc$O* m psf &J=?(z;KX&[qO 6BdP&d- Ѩa7"-G%$x XN@_C ]"= 'F@jmA'P֚-?ŧ 8[U:R!N.-9 / Q%]x1:,D"8Hծ>/UzQS] -F#/6M>& e 2!-QW<%\0 _ 'bGSJv7( 5Il j2Q=c%CZ,6^zJ{_!ӻ#G,v ] |8_<=?yK9z'.=]+$BA0\%8WiL aW[[6 &Fu/K+XQ_`2J!dqv8#<8 +ez $Avo /,.@ 8$C+w 4/qg`AE][[,`V_>;Oz_ ?-'7ok|$Mz*|y-}C 0)s;>+oxU)CEWem%6C{ =i([܇8mMvV4>sbWݶ?: d.T. -:@=+%\0 +B~=} #5 X554Q ;v^5{1u54:v{[!F $Y !ygY*"WKGD!$++-: # @>H G_G>^+c ! 9M_-ٖ p 91 m?8l;IG9:"MUSxD;)c:f_ ALH)"U?`U^k r-I)L 2K/b @?P0݆%"mE"MW ]$ C78 bYA mk3FV 58 41 }#G 1N&} _yEn?]+}(OBSDhp?S,a,<S.yA9! ;`!?)? (7 L] %^ )OL+3| !Zy U}.$k+? |C>M_sLS1D,(gM`y2@) @5.pU~{/FK[c !8 wB%;8aؠ-q"ᗬ=nPA`A+pz0^h!u+o>uX:V& [SO * %~UD%9")15%`AG9FN*:4[ߩ %A3i? -M .7<@Fu)-E -A J}T$5: